BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001840-TA|BGIBMGA001840-PA|IPR005055|Insect pheromone-binding protein A10/OS-D (65 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ973471-1|CAJ01518.1| 122|Anopheles gambiae hypothetical prote... 62 1e-12 AJ697731-1|CAG26924.1| 122|Anopheles gambiae putative chemosens... 62 1e-12 AJ697730-1|CAG26923.1| 122|Anopheles gambiae putative chemosens... 62 1e-12 AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical prote... 60 6e-12 AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory a... 60 6e-12 AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical prote... 58 3e-11 AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory a... 58 3e-11 AJ973473-1|CAJ01520.1| 127|Anopheles gambiae hypothetical prote... 53 9e-10 AF437891-1|AAL84186.1| 127|Anopheles gambiae sensory appendage ... 53 9e-10 AJ973472-1|CAJ01519.1| 168|Anopheles gambiae hypothetical prote... 46 1e-07 AJ697732-1|CAG26925.1| 168|Anopheles gambiae putative chemosens... 46 1e-07 AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 39 2e-05 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 39 2e-05 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 25 0.21 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 0.83 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 21 3.3 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 21 3.3 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 21 4.4 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 21 5.8 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 21 5.8 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 21 5.8 AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 pr... 20 7.7 >AJ973471-1|CAJ01518.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 62.5 bits (145), Expect = 1e-12 Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEK 58 +KT + DAL+T C KC+ QR R+VI HL + +P W +L+D YDP+ +Y K+EK Sbjct: 61 LKT-LPDALKTNCEKCSEKQRTSSRKVIAHLEERKPQEWKKLLDKYDPEGIYKSKFEK 117 >AJ697731-1|CAG26924.1| 122|Anopheles gambiae putative chemosensory protein CSP2 protein. Length = 122 Score = 62.5 bits (145), Expect = 1e-12 Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEK 58 +KT + DAL+T C KC+ QR R+VI HL + +P W +L+D YDP+ +Y K+EK Sbjct: 61 LKT-LPDALKTNCEKCSEKQRTSSRKVIAHLEERKPQEWKKLLDKYDPEGIYKSKFEK 117 >AJ697730-1|CAG26923.1| 122|Anopheles gambiae putative chemosensory protein CSP1 protein. Length = 122 Score = 62.5 bits (145), Expect = 1e-12 Identities = 27/58 (46%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEK 58 +KT + DAL+T C KC+ QR R+VI HL + +P W +L+D YDP+ +Y K+EK Sbjct: 61 LKT-LPDALKTNCEKCSEKQRTSSRKVIAHLEERKPQEWKKLLDKYDPEGIYKSKFEK 117 >AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical protein protein. Length = 126 Score = 60.5 bits (140), Expect = 6e-12 Identities = 23/61 (37%), Positives = 37/61 (60%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEKEL 60 +K + DAL+T C KC+ Q+ G +VI +LID+ W+ L YDP+ +Y KY ++ Sbjct: 60 LKRILPDALKTDCAKCSEKQKSGTEKVINYLIDNRKDQWENLQKKYDPENIYVNKYREDA 119 Query: 61 R 61 + Sbjct: 120 K 120 >AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory appendage protein SAP-3 protein. Length = 126 Score = 60.5 bits (140), Expect = 6e-12 Identities = 23/61 (37%), Positives = 37/61 (60%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEKEL 60 +K + DAL+T C KC+ Q+ G +VI +LID+ W+ L YDP+ +Y KY ++ Sbjct: 60 LKRILPDALKTDCAKCSEKQKSGTEKVINYLIDNRKDQWENLQKKYDPENIYVNKYREDA 119 Query: 61 R 61 + Sbjct: 120 K 120 >AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical protein protein. Length = 127 Score = 58.0 bits (134), Expect = 3e-11 Identities = 24/61 (39%), Positives = 37/61 (60%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEKEL 60 +K + +ALQT C KC+ QR G +VI ++I++ WD L YDP+ +Y KY +E Sbjct: 60 LKKILPEALQTNCEKCSEKQRSGAIKVINYVIENRKEQWDALQKKYDPENLYVEKYREEA 119 Query: 61 R 61 + Sbjct: 120 K 120 >AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory appendage protein SAP-2 protein. Length = 127 Score = 58.0 bits (134), Expect = 3e-11 Identities = 24/61 (39%), Positives = 37/61 (60%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEKEL 60 +K + +ALQT C KC+ QR G +VI ++I++ WD L YDP+ +Y KY +E Sbjct: 60 LKKILPEALQTNCEKCSEKQRSGAIKVINYVIENRKEQWDALQKKYDPENLYVEKYREEA 119 Query: 61 R 61 + Sbjct: 120 K 120 >AJ973473-1|CAJ01520.1| 127|Anopheles gambiae hypothetical protein protein. Length = 127 Score = 53.2 bits (122), Expect = 9e-10 Identities = 24/56 (42%), Positives = 32/56 (57%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKY 56 +K + DALQT C KC+ QR G +VI +LI + WD L +DP+ Y KY Sbjct: 60 LKRILPDALQTNCEKCSEKQRDGAIKVINYLIQNRKDQWDVLQKKFDPENKYLEKY 115 >AF437891-1|AAL84186.1| 127|Anopheles gambiae sensory appendage protein protein. Length = 127 Score = 53.2 bits (122), Expect = 9e-10 Identities = 24/56 (42%), Positives = 32/56 (57%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKY 56 +K + DALQT C KC+ QR G +VI +LI + WD L +DP+ Y KY Sbjct: 60 LKRILPDALQTNCEKCSEKQRDGAIKVINYLIQNRKDQWDVLQKKFDPENKYLEKY 115 >AJ973472-1|CAJ01519.1| 168|Anopheles gambiae hypothetical protein protein. Length = 168 Score = 46.0 bits (104), Expect = 1e-07 Identities = 21/56 (37%), Positives = 32/56 (57%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKY 56 +K ++ DAL + C KC+ QR G +VIK ++ + P + L +YDP Y KY Sbjct: 62 LKDNLPDALMSDCVKCSEKQRIGSDKVIKFIVANRPDDFAILEQLYDPTGEYRRKY 117 >AJ697732-1|CAG26925.1| 168|Anopheles gambiae putative chemosensory protein CSP3 protein. Length = 168 Score = 46.0 bits (104), Expect = 1e-07 Identities = 21/56 (37%), Positives = 32/56 (57%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKY 56 +K ++ DAL + C KC+ QR G +VIK ++ + P + L +YDP Y KY Sbjct: 62 LKDNLPDALMSDCVKCSEKQRIGSDKVIKFIVANRPDDFAILEQLYDPTGEYRRKY 117 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 38.7 bits (86), Expect = 2e-05 Identities = 17/64 (26%), Positives = 35/64 (54%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEKEL 60 +K + +AL+T C +C+ Q++ ++I L P + L + +DP Y ++E+ L Sbjct: 67 LKRILPEALRTKCARCSPIQKENALKIITRLYYDYPDQYRALRERWDPSGEYHRRFEEYL 126 Query: 61 RTIK 64 R ++ Sbjct: 127 RGLQ 130 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 38.7 bits (86), Expect = 2e-05 Identities = 17/64 (26%), Positives = 35/64 (54%) Query: 1 MKTHITDALQTGCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRVYTGKYEKEL 60 +K + +AL+T C +C+ Q++ ++I L P + L + +DP Y ++E+ L Sbjct: 67 LKRILPEALRTKCARCSPIQKENALKIITRLYYDYPDQYRALRERWDPSGEYHRRFEEYL 126 Query: 61 RTIK 64 R ++ Sbjct: 127 RGLQ 130 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 25.4 bits (53), Expect = 0.21 Identities = 12/40 (30%), Positives = 20/40 (50%) Query: 12 GCTKCTGAQRKGIRRVIKHLIDSEPGYWDRLVDMYDPKRV 51 G C +KG +++H+ S PGY L ++ + K V Sbjct: 207 GFLSCRQLPKKGTGELLEHMEPSGPGYSSNLYNVDNLKLV 246 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.4 bits (48), Expect = 0.83 Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDMYDP 48 A+RK + V++ PG +DR+++M P Sbjct: 505 ARRKKKQEVVELFKLEVPGVYDRMINMCQP 534 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.4 bits (43), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQNYWDRLFDI 164 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.4 bits (43), Expect = 3.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQNYWDRLFDI 164 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 21.0 bits (42), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVDM 45 A++ + R +D YWDRL D+ Sbjct: 138 ARKYPVLRYRFETMDDLQDYWDRLFDI 164 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 20.6 bits (41), Expect = 5.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVD 44 A++ + R +D YWDRL D Sbjct: 127 ARKYPVLRYRFETMDDLQDYWDRLFD 152 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 20.6 bits (41), Expect = 5.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLVD 44 A++ + R +D YWDRL D Sbjct: 127 ARKYPVLRYRFETMDDLQDYWDRLFD 152 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 20.6 bits (41), Expect = 5.8 Identities = 8/25 (32%), Positives = 12/25 (48%) Query: 19 AQRKGIRRVIKHLIDSEPGYWDRLV 43 AQR+G+ + E G W +V Sbjct: 221 AQRQGVTESASSAVPDEAGTWVEVV 245 >AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 protein. Length = 159 Score = 20.2 bits (40), Expect = 7.7 Identities = 7/19 (36%), Positives = 9/19 (47%) Query: 32 IDSEPGYWDRLVDMYDPKR 50 I P YW D + P+R Sbjct: 100 IHRNPAYWGSDADRFRPER 118 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.321 0.137 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,214 Number of Sequences: 2123 Number of extensions: 2188 Number of successful extensions: 61 Number of sequences better than 10.0: 61 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of query: 65 length of database: 516,269 effective HSP length: 43 effective length of query: 22 effective length of database: 424,980 effective search space: 9349560 effective search space used: 9349560 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.4 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -