BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001836-TA|BGIBMGA001836-PA|IPR002048|Calcium-binding EF-hand, IPR013032|EGF-like region, IPR001881|EGF-like calcium-binding, IPR006210|EGF, IPR009030|Growth factor, receptor, IPR013091|EGF calcium-binding, IPR003367|Thrombospondin type 3 repeat, IPR008859|Thrombospondin, C-terminal (804 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21230.1 68414.m02653 wall-associated kinase, putative simila... 38 0.026 At1g16110.1 68414.m01931 wall-associated kinase, putative contai... 38 0.035 At1g21270.1 68414.m02658 wall-associated kinase 2 (WAK2) identic... 37 0.061 At2g34940.1 68415.m04289 vacuolar sorting receptor, putative sim... 36 0.080 At4g20110.1 68417.m02943 vacuolar sorting receptor, putative sim... 36 0.11 At1g30900.1 68414.m03780 vacuolar sorting receptor, putative sim... 35 0.19 At2g30290.1 68415.m03687 vacuolar sorting receptor, putative sim... 34 0.32 At1g16120.1 68414.m01932 wall-associated kinase, putative contai... 34 0.32 At3g05460.1 68416.m00598 sporozoite surface protein-related cont... 33 0.57 At3g52850.1 68416.m05824 vacuolar sorting receptor, putative nea... 33 0.75 At3g29040.1 68416.m03633 receptor-like protein kinase-related co... 33 0.75 At1g21240.1 68414.m02654 wall-associated kinase, putative simila... 33 0.99 At1g22720.1 68414.m02839 wall-associated kinase, putative contai... 32 1.3 At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein... 31 2.3 At1g79670.2 68414.m09292 wall-associated kinase, putative simila... 31 2.3 At1g79670.1 68414.m09291 wall-associated kinase, putative simila... 31 2.3 At1g16140.1 68414.m01934 wall-associated kinase, putative contai... 31 2.3 At1g72440.1 68414.m08377 CCAAT-box-binding transcription factor-... 31 4.0 At2g23240.2 68415.m02776 plant EC metallothionein-like family 15... 30 7.0 At5g18750.1 68418.m02226 DNAJ heat shock N-terminal domain-conta... 29 9.2 At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nea... 29 9.2 At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nea... 29 9.2 At1g01960.1 68414.m00114 guanine nucleotide exchange family prot... 29 9.2 >At1g21230.1 68414.m02653 wall-associated kinase, putative similar to wall-associated kinase 1 [Arabidopsis thaliana] GI:3549626; expressed in leaves and stems & induced by salicylic acid or INA (PMID:10380805) Length = 733 Score = 37.9 bits (84), Expect = 0.026 Identities = 30/81 (37%), Positives = 35/81 (43%), Gaps = 10/81 (12%) Query: 45 QTCRTACSANPCFGGRVPCQDLPDGR-YQCGKCPSGFHGN---GVECYRIS-C--RANTC 97 QTC N C GG C D G+ Y C KC GF GN C I+ C R + C Sbjct: 233 QTCEQVVGRNIC-GGNSTCFDSTRGKGYNC-KCLQGFDGNPYLSDGCQDINECTTRIHNC 290 Query: 98 FQGVSCEETQYGPKCGSCPTG 118 +CE T C CP+G Sbjct: 291 SDTSTCENTLGSFHC-QCPSG 310 >At1g16110.1 68414.m01931 wall-associated kinase, putative contains similarity to wall-associated kinase 2 GI:4826399 from [Arabidopsis thaliana] Length = 642 Score = 37.5 bits (83), Expect = 0.035 Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Query: 210 TGNERRREHCVDVDECADGRANCPRGRLCVNTP 242 TGN R C+D+DEC +G NC G CVN P Sbjct: 311 TGNPYLRHGCIDIDEC-EGHHNCGEG-TCVNMP 341 >At1g21270.1 68414.m02658 wall-associated kinase 2 (WAK2) identical to wall-associated kinase 2 [Arabidopsis thaliana] GI:4826399; induced by salicylic acid or INA (PMID:10380805) Length = 732 Score = 36.7 bits (81), Expect = 0.061 Identities = 32/88 (36%), Positives = 39/88 (44%), Gaps = 16/88 (18%) Query: 45 QTCRTACSANPCFGGRVPCQDLPDGR-YQCGKCPSGFHGNGV---------ECYRISCRA 94 +TC+ C GG C D G Y C KC GF GN EC IS R Sbjct: 232 KTCKQVEYRGVC-GGNSTCFDSTGGTGYNC-KCLEGFEGNPYLPNGCQDINEC--ISSRH 287 Query: 95 NTCFQGVSCEETQYGPKCGSCPTGYVGD 122 N C + +CE T+ C +CP+GY D Sbjct: 288 N-CSEHSTCENTKGSFNC-NCPSGYRKD 313 Score = 29.9 bits (64), Expect = 7.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Query: 211 GNERRREHCVDVDECADGRANCPRGRLCVNT 241 GN C D++EC R NC C NT Sbjct: 268 GNPYLPNGCQDINECISSRHNCSEHSTCENT 298 >At2g34940.1 68415.m04289 vacuolar sorting receptor, putative similar to BP-80 vacuolar sorting receptor [Pisum sativum] GI:1737222 Length = 618 Score = 36.3 bits (80), Expect = 0.080 Identities = 29/101 (28%), Positives = 40/101 (39%), Gaps = 19/101 (18%) Query: 68 DGRYQCGKC-PSGFHGNGVECYRISCRANTCFQGVSCEETQYGPKCGSCPTGYVGDGRQC 126 DG C P+ N +C+ R F S ET C CP G++GDG +C Sbjct: 456 DGYTSCKPYGPARCSMNNGDCWS-ETRKGLTFSSCSDSETS---GC-RCPLGFLGDGLKC 510 Query: 127 QHVCDAQKPCGRERRCMPKSTSPYYECEGCPSGYQWNGYTC 167 + + + C KS +C+GC W GY C Sbjct: 511 EDIDE----------CKEKSAC---KCDGCKCKNNWGGYEC 538 Score = 31.5 bits (68), Expect = 2.3 Identities = 31/100 (31%), Positives = 43/100 (43%), Gaps = 15/100 (15%) Query: 102 SCEETQYGPKCGSCPT----GYVGDG-RQCQHVCDAQ-----KPCGRE-RRCMPKSTSPY 150 +C++T G C CP Y GDG C+ A+ C E R+ + S+ Sbjct: 433 ACKDTFRGRVC-ECPVVDGVQYKGDGYTSCKPYGPARCSMNNGDCWSETRKGLTFSSCSD 491 Query: 151 YECEGC--PSGYQWNGYTCVDMDECDLIRPCD-DLVSCRN 187 E GC P G+ +G C D+DEC C D C+N Sbjct: 492 SETSGCRCPLGFLGDGLKCEDIDECKEKSACKCDGCKCKN 531 >At4g20110.1 68417.m02943 vacuolar sorting receptor, putative similar to BP-80 vacuolar sorting receptor [Pisum sativum] GI:1737222; identical to vacuolar sorting receptor-like protein (GI:2827665) [Arabidopsis thaliana] Length = 625 Score = 35.9 bits (79), Expect = 0.11 Identities = 40/122 (32%), Positives = 50/122 (40%), Gaps = 21/122 (17%) Query: 24 CVDTDQGFRCERCP---GSQ-TSDGQTCRTACSANPCFGGRVPC-QDLPDGRY--QCG-- 74 C DT +G CE CP G Q DG T T C C D +G C Sbjct: 436 CQDTFRGRLCE-CPVVKGVQYKGDGYTSCTPYGPARCTMNNGGCWSDTRNGLTFSACSDS 494 Query: 75 -----KCPSGFHGNGVECYRIS-CRANTCFQ--GVSCEETQYGPKCGSCPTG--YVGDGR 124 KCP GF G+G+ C I+ C+ + Q G C+ + G KC SC Y+ D Sbjct: 495 VSTGCKCPEGFQGDGLTCEDINECKERSVCQCSGCRCKNSWGGYKC-SCSGDRLYINDQD 553 Query: 125 QC 126 C Sbjct: 554 TC 555 Score = 31.9 bits (69), Expect = 1.7 Identities = 16/53 (30%), Positives = 21/53 (39%), Gaps = 13/53 (24%) Query: 115 CPTGYVGDGRQCQHVCDAQKPCGRERRCMPKSTSPYYECEGCPSGYQWNGYTC 167 CP G+ GDG C+ + C +S +C GC W GY C Sbjct: 501 CPEGFQGDGLTCEDI----------NECKERSVC---QCSGCRCKNSWGGYKC 540 Score = 31.5 bits (68), Expect = 2.3 Identities = 10/18 (55%), Positives = 14/18 (77%) Query: 156 CPSGYQWNGYTCVDMDEC 173 CP G+Q +G TC D++EC Sbjct: 501 CPEGFQGDGLTCEDINEC 518 >At1g30900.1 68414.m03780 vacuolar sorting receptor, putative similar to BP-80 vacuolar sorting receptor [Pisum sativum] GI:1737222 Length = 631 Score = 35.1 bits (77), Expect = 0.19 Identities = 31/101 (30%), Positives = 45/101 (44%), Gaps = 15/101 (14%) Query: 102 SCEETQYGPKCGSCPT----GYVGDG-RQCQHVCDA-----QKPCGRE-RRCMPKSTSPY 150 +C++T G C CP Y GDG C+ A Q C E ++ + S Sbjct: 434 ACKDTFRGRVC-ECPVVNGVQYKGDGYTSCEPYGPARCSINQGGCWSETKKGLTFSACSN 492 Query: 151 YECEGC--PSGYQWNGYTCVDMDECDLIRPCD-DLVSCRNE 188 E GC P G++ +G C D+DEC C D +C+N+ Sbjct: 493 LETSGCRCPPGFKGDGLKCEDIDECKEQSACQCDGCNCKNK 533 Score = 33.5 bits (73), Expect = 0.57 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 13/53 (24%) Query: 115 CPTGYVGDGRQCQHVCDAQKPCGRERRCMPKSTSPYYECEGCPSGYQWNGYTC 167 CP G+ GDG +C+ + + C + C +C+GC +W G+ C Sbjct: 500 CPPGFKGDGLKCEDIDE----CKEQSAC---------QCDGCNCKNKWGGFEC 539 Score = 29.9 bits (64), Expect = 7.0 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Query: 75 KCPSGFHGNGVECYRI-SCRANTCFQ--GVSCEETQYGPKC 112 +CP GF G+G++C I C+ + Q G +C+ G +C Sbjct: 499 RCPPGFKGDGLKCEDIDECKEQSACQCDGCNCKNKWGGFEC 539 >At2g30290.1 68415.m03687 vacuolar sorting receptor, putative similar to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737218 Length = 625 Score = 34.3 bits (75), Expect = 0.32 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 4/42 (9%) Query: 115 CPTGYVGDG-RQCQHV--CDAQKPCGRERRCMPKSTSPYYEC 153 CP G++GDG ++C+ V C+ + C + R C K+T YEC Sbjct: 502 CPPGFIGDGLKECKDVNECEEKTAC-QCRDCKCKNTWGSYEC 542 >At1g16120.1 68414.m01932 wall-associated kinase, putative contains similarity to wall-associated kinase 4 GI:3355308 from [Arabidopsis thaliana] Length = 730 Score = 34.3 bits (75), Expect = 0.32 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 210 TGNERRREHCVDVDECADGRANCPRGRLCVNTP 242 TGN R CVD D C +G NC CVN P Sbjct: 304 TGNPYLRGGCVDTDSC-EGNHNCGEDAHCVNMP 335 >At3g05460.1 68416.m00598 sporozoite surface protein-related contains weak similarity to Sporozoite surface protein 2 precursor (Swiss-Prot:Q01443) [Plasmodium berghei yoelii] Length = 152 Score = 33.5 bits (73), Expect = 0.57 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Query: 233 PRGRLCVNTPQYPSNPVSSLQGSYICVPCGGHYYVNTTRPC--FDPDSLVKRCDP 285 PR C++ P P NP ++ I P G Y++ PC DP +VK C+P Sbjct: 53 PRDPKCIDKPCNPENPNCRMEQGAI-KPNRGSGYLHDDPPCNPRDPKCIVKPCNP 106 >At3g52850.1 68416.m05824 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog (GP:1737218) [Arabidopsis thaliana] Length = 623 Score = 33.1 bits (72), Expect = 0.75 Identities = 37/113 (32%), Positives = 49/113 (43%), Gaps = 20/113 (17%) Query: 24 CVDTDQGFRCERCPGSQ----TSDGQT-CRTA----CSANP--CF----GGRVPCQDLPD 68 C DT +G CE CP Q DG T C+ + C N C+ GG + D Sbjct: 433 CRDTFRGRLCE-CPTVQGVKFVGDGYTHCKASGALHCGINNGGCWRESRGGFTYSACVDD 491 Query: 69 GRYQCGKCPSGFHGNGVE-CYRI-SCRANTCFQGVSCE-ETQYGPKCGSCPTG 118 C KCP GF G+GV+ C + C+ T Q C+ + +G SC G Sbjct: 492 HSKDC-KCPLGFKGDGVKNCEDVDECKEKTVCQCPECKCKNTWGSYECSCSNG 543 >At3g29040.1 68416.m03633 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function that is usually associated with protein kinase domain Pfam:PF00069 Length = 248 Score = 33.1 bits (72), Expect = 0.75 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Query: 81 HGNGVECYRISCRANTCFQGVSCEETQYGPKCGSC-PTGYVGDGRQCQ 127 + + VE Y +S N F + C YG KC SC T + G +C+ Sbjct: 61 YNSNVEAYEVSKDPNIVFVLLQCRGDSYGSKCHSCLHTAFSGLRERCR 108 >At1g21240.1 68414.m02654 wall-associated kinase, putative similar to wall-associated kinase 1 [Arabidopsis thaliana] GI:3549626; expressed in leaves and stems & induced by salicylic acid or INA (PMID:10380805) Length = 741 Score = 32.7 bits (71), Expect = 0.99 Identities = 20/67 (29%), Positives = 27/67 (40%), Gaps = 12/67 (17%) Query: 211 GNERRREHCVDVDECADGRANCPRGRLCVNTPQYPSNPVSSLQGSYICVPCGGHYYVNTT 270 GN R E C D+DEC NC + C N G + C C Y +N++ Sbjct: 283 GNPYRSEGCKDIDECISDTHNCSDPKTCRNR-----------DGGFDC-KCPSGYDLNSS 330 Query: 271 RPCFDPD 277 C P+ Sbjct: 331 MSCTRPE 337 Score = 29.9 bits (64), Expect = 7.0 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 5/52 (9%) Query: 294 VCGFGQKCVCNTGWTGNGTVCGLDRDLDGHPDEQLPCNE-PRCKKD--NCPD 342 +CG C +T T NG +C + DG+P C + C D NC D Sbjct: 257 ICGKNSSCYNST--TRNGYICKCNEGYDGNPYRSEGCKDIDECISDTHNCSD 306 >At1g22720.1 68414.m02839 wall-associated kinase, putative contains similarity to serine/threonine kinase gb|Y12531 from Brassica oleracea Length = 219 Score = 32.3 bits (70), Expect = 1.3 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Query: 210 TGNERRREHCVDVDEC---ADGRAN-CPRGRLCVNTPQ 243 TGN C D+DEC A+GR N C G C N+P+ Sbjct: 10 TGNPYVLNGCKDIDECKELANGRPNICTDGGTCQNSPE 47 >At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein contains PF01422: NF-X1 type zinc finger Length = 912 Score = 31.5 bits (68), Expect = 2.3 Identities = 39/144 (27%), Positives = 52/144 (36%), Gaps = 28/144 (19%) Query: 20 VGERCVDTDQGFRCER-CPGSQTSDGQTCRTACSANPCFGGRVPCQDLPDGRYQC--GKC 76 V ++ V Q CER C + CR C C G PC ++ + +C KC Sbjct: 387 VTKKQVPCHQELACERKCQRVRDCARHACRRRC----CDGECPPCSEICGKKLRCRNHKC 442 Query: 77 PSGFH-GNGVEC---YRISCRANTCFQGVSC--EETQYGPKCGS-------CPTG----- 118 S H G C ISC V C E Q P+C C G Sbjct: 443 QSPCHQGPCAPCPIMVTISCACGETHFEVPCGTETNQKPPRCRKLCHITPLCRHGQNQKP 502 Query: 119 ---YVGDGRQCQHVCDAQKPCGRE 139 + G C+ +CD + PCG + Sbjct: 503 HKCHYGACPPCRLLCDEEYPCGHK 526 >At1g79670.2 68414.m09292 wall-associated kinase, putative similar to wall-associated kinase 4 GI:3355308 from [Arabidopsis thaliana]; isoform contains non-consensus AT-acceptor splice site. Length = 714 Score = 31.5 bits (68), Expect = 2.3 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 211 GNERRREHCVDVDECADGRANCPRGRL-CVNTP 242 GN C+D+DEC +G+ G L CVN P Sbjct: 262 GNPYLPGGCIDIDECEEGKGLSSCGELTCVNVP 294 >At1g79670.1 68414.m09291 wall-associated kinase, putative similar to wall-associated kinase 4 GI:3355308 from [Arabidopsis thaliana]; isoform contains non-consensus AT-acceptor splice site. Length = 751 Score = 31.5 bits (68), Expect = 2.3 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 211 GNERRREHCVDVDECADGRANCPRGRL-CVNTP 242 GN C+D+DEC +G+ G L CVN P Sbjct: 299 GNPYLPGGCIDIDECEEGKGLSSCGELTCVNVP 331 >At1g16140.1 68414.m01934 wall-associated kinase, putative contains similarity to wall-associated kinase 4 GI:3355308 from [Arabidopsis thaliana] Length = 690 Score = 31.5 bits (68), Expect = 2.3 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 4/39 (10%) Query: 146 STSPYYECEGCPSGYQWNGYT---CVDMDECDLIRPCDD 181 S Y C C SGY+ N Y C+D+DEC++ C + Sbjct: 265 SRMSYRSCY-CGSGYRGNPYIRGGCIDIDECEVPNKCGE 302 >At1g72440.1 68414.m08377 CCAAT-box-binding transcription factor-related similar to CCAAT-box-binding transcription factor (CCAAT-binding factor) (CBF) (Swiss-Prot:Q03701) [Homo sapiens], GB:P53569 [Mus musculus] Length = 1056 Score = 30.7 bits (66), Expect = 4.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 537 IVPNRDQKDSDNDGIGDACDNDIDGD 562 ++ + D + D+DG GD D+D DGD Sbjct: 972 LIDDEDDNNVDDDGTGDGGDDDSDGD 997 >At2g23240.2 68415.m02776 plant EC metallothionein-like family 15 protein identical to EC protein homolog 2 (SP:Q42377) {Arabidopsis thaliana}; identical to an EST: GB:X92116:ATECPRHOM; contains a vertebrate metallothionein signature (PS00203); contains Pfam profile PF02068: Plant PEC family metallothionein Length = 84 Score = 29.9 bits (64), Expect = 7.0 Identities = 21/78 (26%), Positives = 30/78 (38%), Gaps = 7/78 (8%) Query: 42 SDGQTCRTACSA-NPCFGG---RVPCQDLPDGRYQCGKCPSGFHGNGVECYRISCRANTC 97 S +C C +PC GG R+ + G + CP G H C + T Sbjct: 8 SASASCNDRCGCPSPCPGGESCRLMMSEASGGDQEHNTCPCGEHCGCNPCNCPKTQTQTS 67 Query: 98 FQGVSCEETQYGPKCGSC 115 +G +C E G C +C Sbjct: 68 AKGCTCGE---GCTCATC 82 >At5g18750.1 68418.m02226 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 884 Score = 29.5 bits (63), Expect = 9.2 Identities = 21/75 (28%), Positives = 32/75 (42%), Gaps = 4/75 (5%) Query: 704 GKILRNALWNTNSTPDQVTLLWKDPRNVGWREQTAYRWKLLHRPKIGLIRLKMYENNRLV 763 GK +W+ NS D + + + + WR + L PK L + + + R+ Sbjct: 674 GKFAPGQIWSLNSKEDGLPKCYAKIQQIVWRPVFKLQINRL-EPKSLLENVIQWHDKRMP 732 Query: 764 ADSGNTYDFTLKGGR 778 GN FTLK GR Sbjct: 733 VSCGN---FTLKEGR 744 >At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 29.5 bits (63), Expect = 9.2 Identities = 20/74 (27%), Positives = 28/74 (37%), Gaps = 13/74 (17%) Query: 111 KCGSCPTGYVGDGRQCQHVCDAQKPCGRERRCMPKSTSPYYECEGCPSGYQWNGYTCVDM 170 KC CP G+ GDG + C+ C ++ C +C C W Y C Sbjct: 500 KC-ECPPGFKGDGTK---KCEDINECKEKKAC---------QCPECSCKNTWGSYECSCS 546 Query: 171 DECDLIRPCDDLVS 184 + IR D +S Sbjct: 547 GDLLYIRDHDTCIS 560 >At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 29.5 bits (63), Expect = 9.2 Identities = 20/74 (27%), Positives = 28/74 (37%), Gaps = 13/74 (17%) Query: 111 KCGSCPTGYVGDGRQCQHVCDAQKPCGRERRCMPKSTSPYYECEGCPSGYQWNGYTCVDM 170 KC CP G+ GDG + C+ C ++ C +C C W Y C Sbjct: 500 KC-ECPPGFKGDGTK---KCEDINECKEKKAC---------QCPECSCKNTWGSYECSCS 546 Query: 171 DECDLIRPCDDLVS 184 + IR D +S Sbjct: 547 GDLLYIRDHDTCIS 560 >At1g01960.1 68414.m00114 guanine nucleotide exchange family protein similar to guanine nucleotide exchange factor [Homo sapiens] GI:5456754; contains Pfam profile PF01369: Sec7 domain Length = 1750 Score = 29.5 bits (63), Expect = 9.2 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 6/69 (8%) Query: 729 RNVGWREQTAYRWKLLHRPKIGLIRLKMYENNRLVAD--SGNTYDFTLKGGRLGVFCFSQ 786 +N WR+ + KL H K + RL+ EN+ VAD SG++ L G + ++ Sbjct: 23 KNASWRKHS----KLAHECKSVIERLRSPENSSPVADSESGSSIPGPLHDGGAAEYSLAE 78 Query: 787 EMIIWSNLL 795 II S L+ Sbjct: 79 SEIILSPLI 87 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.320 0.139 0.470 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,832,770 Number of Sequences: 28952 Number of extensions: 938942 Number of successful extensions: 1842 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 18 Number of HSP's that attempted gapping in prelim test: 1811 Number of HSP's gapped (non-prelim): 54 length of query: 804 length of database: 12,070,560 effective HSP length: 87 effective length of query: 717 effective length of database: 9,551,736 effective search space: 6848594712 effective search space used: 6848594712 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 63 (29.5 bits)
- SilkBase 1999-2023 -