BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001827-TA|BGIBMGA001827-PA|IPR000504|RNA-binding region RNP-1 (RNA recognition motif) (334 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 24 6.9 DQ974171-1|ABJ52811.1| 403|Anopheles gambiae serpin 14 protein. 23 9.1 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 23.8 bits (49), Expect = 6.9 Identities = 17/50 (34%), Positives = 22/50 (44%) Query: 127 FQDESSVAALMEACITDEDKLYLCVSSPTIRDKPVQIRPWRLADADFVLD 176 FQ E A + + C LY C SS + R V+ RL D VL+ Sbjct: 227 FQGEQLKARIKKVCTGYHVSLYPCPSSGSERTDMVKGVCTRLEDLRMVLN 276 >DQ974171-1|ABJ52811.1| 403|Anopheles gambiae serpin 14 protein. Length = 403 Score = 23.4 bits (48), Expect = 9.1 Identities = 8/19 (42%), Positives = 15/19 (78%) Query: 184 RKTVFVGGVPRPLKAVELA 202 R T+F+G VP+ L+ ++L+ Sbjct: 168 RDTLFLGDVPKQLQMIQLS 186 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.323 0.138 0.437 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 343,105 Number of Sequences: 2123 Number of extensions: 14161 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 2 length of query: 334 length of database: 516,269 effective HSP length: 64 effective length of query: 270 effective length of database: 380,397 effective search space: 102707190 effective search space used: 102707190 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -