BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001825-TA|BGIBMGA001825-PA|IPR006649|Like-Sm ribonucleoprotein, eukaryotic and archaea-type, core, IPR010920|Like-Sm ribonucleoprotein-related, core, IPR001163|Like-Sm ribonucleoprotein, core (139 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27720.1 68418.m03325 small nuclear ribonucleoprotein, putati... 171 1e-43 At1g20580.1 68414.m02569 small nuclear ribonucleoprotein, putati... 66 1e-11 At1g76300.1 68414.m08862 small nuclear ribonucleoprotein D3, put... 65 2e-11 At1g03330.1 68414.m00312 small nuclear ribonucleoprotein D, puta... 47 4e-06 At4g02840.1 68417.m00384 small nuclear ribonucleoprotein D1, put... 39 0.001 At3g07590.1 68416.m00909 small nuclear ribonucleoprotein D1, put... 37 0.004 At3g59810.1 68416.m06674 small nuclear ribonucleoprotein F, puta... 37 0.006 At4g30220.1 68417.m04298 small nuclear ribonucleoprotein F, puta... 35 0.023 At2g43810.1 68415.m05446 small nuclear ribonucleoprotein F, puta... 34 0.031 At4g03960.1 68417.m00559 tyrosine specific protein phosphatase f... 30 0.50 At1g05000.1 68414.m00501 tyrosine specific protein phosphatase f... 30 0.66 At2g32960.1 68415.m04040 tyrosine specific protein phosphatase f... 29 0.87 At3g02800.1 68416.m00272 tyrosine specific protein phosphatase f... 29 1.2 At5g16480.1 68418.m01926 tyrosine specific protein phosphatase f... 29 1.5 At5g44980.1 68418.m05516 F-box family protein contains F-box dom... 27 3.5 At3g18295.1 68416.m02327 expressed protein 27 3.5 At1g08750.3 68414.m00974 GPI-anchor transamidase, putative simil... 27 6.1 At1g08750.2 68414.m00973 GPI-anchor transamidase, putative simil... 27 6.1 At1g08750.1 68414.m00972 GPI-anchor transamidase, putative simil... 27 6.1 At4g18372.1 68417.m02725 small nuclear ribonucleoprotein-related... 26 8.1 At1g78760.1 68414.m09179 F-box family protein contains F-box dom... 26 8.1 >At5g27720.1 68418.m03325 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to SWISS-PROT:Q9QXA5 U6 snRNA-associated Sm-like protein LSm4 [Mus musculus] Length = 129 Score = 171 bits (416), Expect = 1e-43 Identities = 76/101 (75%), Positives = 87/101 (86%) Query: 1 MLPLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECY 60 MLPLSLL+TAQ HPMLVELKNGETYNGHLV+CD WMNI+LREVICTS+DGD+FWRMPECY Sbjct: 1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY 60 Query: 61 IRGSTIKYLRIPDEVIDMVKEETQVKARGRNEVSKGRGQNM 101 IRG+TIKYLR+PDEVID V+EE R V +GRG+ + Sbjct: 61 IRGNTIKYLRVPDEVIDKVQEEKTRTDRKPPGVGRGRGRGV 101 >At1g20580.1 68414.m02569 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3, Sm-D3) [Mus musculus] SWISS-PROT:P43331 Length = 131 Score = 65.7 bits (153), Expect = 1e-11 Identities = 37/102 (36%), Positives = 61/102 (59%), Gaps = 7/102 (6%) Query: 2 LPLSLLRTAQNHPMLVELKNGETYNGHLVSC-DNWMNINLREVICTSRDGDKFWRMPECY 60 +P+ LL A H + VELK+GE Y G ++ C DNW N L ++ T++DG K ++ + Sbjct: 7 IPVKLLHEASGHIVTVELKSGELYRGSMIECEDNW-NCQLEDITYTAKDG-KVSQLEHVF 64 Query: 61 IRGSTIKYLRIPD--EVIDMVKE-ETQVKARGRN-EVSKGRG 98 IRGS ++++ IPD + M K + ++K + + V +GRG Sbjct: 65 IRGSKVRFMVIPDILKHAPMFKRLDARIKGKSSSLGVGRGRG 106 >At1g76300.1 68414.m08862 small nuclear ribonucleoprotein D3, putative / snRNP core protein D3, putative / Sm protein D3, putative similar to SWISS-PROT:P43331 small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3, Sm-D3) [Mouse] Length = 128 Score = 64.9 bits (151), Expect = 2e-11 Identities = 36/104 (34%), Positives = 60/104 (57%), Gaps = 7/104 (6%) Query: 2 LPLSLLRTAQNHPMLVELKNGETYNGHLVSC-DNWMNINLREVICTSRDGDKFWRMPECY 60 +P+ LL + H + VE+K+GE Y G ++ C DNW N L + T++DG K ++ + Sbjct: 7 IPVKLLHESSGHIVSVEMKSGELYRGSMIECEDNW-NCQLENITYTAKDG-KVSQLEHVF 64 Query: 61 IRGSTIKYLRIPDEVIDMVKEETQVKARGRNE---VSKGRGQNM 101 IRGS +++L IPD ++ V+ +G++ V +GRG M Sbjct: 65 IRGSLVRFLVIPD-MLKNAPMFKDVRGKGKSASLGVGRGRGAAM 107 >At1g03330.1 68414.m00312 small nuclear ribonucleoprotein D, putative / snRNP core SM-like protein, putative / U6 snRNA-associated Sm-like protein, putative similar to SWISS-PROT:Q9Y333 U6 snRNA-associated Sm-like protein LSm2 (Small nuclear ribonuclear protein D homolog, G7b, SnRNP core SM-like protein SM-x5) [Homo sapiens] Length = 93 Score = 47.2 bits (107), Expect = 4e-06 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 7/94 (7%) Query: 1 MLPLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRM---P 57 ML S + + VELKN G L S D ++NI L D DK+ M Sbjct: 1 MLFFSYFKDLVGQEVTVELKNDLAIRGTLHSVDQYLNIKLENTRVV--DQDKYPHMLSVR 58 Query: 58 ECYIRGSTIKYLRIP-DEV-IDMVKEETQVKARG 89 C+IRGS ++Y+++P D V +D++ + + +ARG Sbjct: 59 NCFIRGSVVRYVQLPKDGVDVDLLHDAARREARG 92 >At4g02840.1 68417.m00384 small nuclear ribonucleoprotein D1, putative / snRNP core protein D1, putative / Sm protein D1, putative similar to small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1, Sm-D1, Sm-D autoantigen) [Mouse] SWISS-PROT:P13641 Length = 116 Score = 38.7 bits (86), Expect = 0.001 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 8/100 (8%) Query: 7 LRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTI 66 L N + +ELKNG +G + D MN +L+ V T + G + +RG+ I Sbjct: 7 LMKLNNETVSIELKNGTIVHGTITGVDVSMNTHLKAVKLTLK-GKNPVTLDHLSVRGNNI 65 Query: 67 KYLRIPDEV---IDMVKEETQVKAR----GRNEVSKGRGQ 99 +Y +PD + +V++ ++K + G+ +GRG+ Sbjct: 66 RYYILPDSLNLETLLVEDTPRIKPKKPTAGKIPAGRGRGR 105 >At3g07590.1 68416.m00909 small nuclear ribonucleoprotein D1, putative / snRNP core protein D1, putative / Sm protein D1, putative similar to SWISS-PROT:SP|P13641 small nuclear ribonucleoprotein Sm D1 (snRNP core protein D1, Sm-D1, Sm-D autoantigen)[Mouse] Length = 114 Score = 37.1 bits (82), Expect = 0.004 Identities = 27/99 (27%), Positives = 47/99 (47%), Gaps = 7/99 (7%) Query: 7 LRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTI 66 L N + +ELKNG +G + D MN +L+ + S G + +RG+ I Sbjct: 7 LMKLNNETVSIELKNGTVVHGTITGVDVSMNTHLK-TVKMSLKGKNPVTLDHLSLRGNNI 65 Query: 67 KYLRIPDEV---IDMVKEETQVKAR---GRNEVSKGRGQ 99 +Y +PD + +V++ +VK + V +GRG+ Sbjct: 66 RYYILPDSLNLETLLVEDTPRVKPKKPVAGKAVGRGRGR 104 >At3g59810.1 68416.m06674 small nuclear ribonucleoprotein F, putative / U6 snRNA-associated Sm-like protein, putative / Sm protein F, putative similar to SWISS-PROT:Q9Y4Y8 U6 snRNA-associated Sm-like protein LSm6 [Mus musculus] Length = 91 Score = 36.7 bits (81), Expect = 0.006 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Query: 3 PLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIR 62 P L++ + P++V+L +G Y G L D +MNI + + +G + + +IR Sbjct: 15 PADFLKSIRGRPVVVKLNSGVDYRGTLTCLDGYMNIAMEQTE-EYVNGQLKNKYGDAFIR 73 Query: 63 GSTIKYL 69 G+ + Y+ Sbjct: 74 GNNVLYI 80 >At4g30220.1 68417.m04298 small nuclear ribonucleoprotein F, putative / snRNP-F, putative / Sm protein F, putative similar to SWISS-PROT:Q15356 small nuclear ribonucleoprotein F (snRNP-F, Sm protein F, Sm-F, SmF) [Mouse] Length = 88 Score = 34.7 bits (76), Expect = 0.023 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 2/73 (2%) Query: 3 PLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIR 62 P L ++V+LK G Y G L S D++MN+ L DG + E IR Sbjct: 8 PKPFLNNLTGKTVIVKLKWGMEYKGFLASVDSYMNLQLGNTE-EYIDGQLTGNLGEILIR 66 Query: 63 GSTIKYLR-IPDE 74 + + Y+R +P++ Sbjct: 67 CNNVLYVRGVPED 79 >At2g43810.1 68415.m05446 small nuclear ribonucleoprotein F, putative / U6 snRNA-associated Sm-like protein, putative / Sm protein F, putative similar to SWISS-PROT:Q9Y4Y8 U6 snRNA-associated Sm-like protein LSm6 [Mus musculus] Length = 91 Score = 34.3 bits (75), Expect = 0.031 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Query: 3 PLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIR 62 P L++ + P++V+L +G Y G L D +MNI + + +G + ++R Sbjct: 15 PADFLKSIRGKPVVVKLNSGVDYRGILTCLDGYMNIAMEQTE-EYVNGQLKNTYGDAFVR 73 Query: 63 GSTIKYL 69 G+ + Y+ Sbjct: 74 GNNVLYI 80 >At4g03960.1 68417.m00559 tyrosine specific protein phosphatase family protein contains tyrosine specific protein phosphatases active site, PROSITE:PS00383 Length = 198 Score = 30.3 bits (65), Expect = 0.50 Identities = 12/29 (41%), Positives = 18/29 (62%) Query: 4 LSLLRTAQNHPMLVELKNGETYNGHLVSC 32 L +L +NHP+L+ K+G+ G LV C Sbjct: 111 LQVLLDTENHPVLIHCKSGKHRTGCLVGC 139 >At1g05000.1 68414.m00501 tyrosine specific protein phosphatase family protein contains tyrosine specific protein phosphatases active site, PROSITE:PS00383 Length = 215 Score = 29.9 bits (64), Expect = 0.66 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 5/72 (6%) Query: 2 LPLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYI 61 + L +L +NHP+L+ K G+ G LV C + + C + D++ R Sbjct: 133 MALKVLLDEKNHPVLIHCKRGKHRTGCLVGC-----LRKLQKWCLTSIFDEYQRFAAAKA 187 Query: 62 RGSTIKYLRIPD 73 R S +++ I D Sbjct: 188 RVSDQRFMEIFD 199 >At2g32960.1 68415.m04040 tyrosine specific protein phosphatase family protein contains Pfam profile PF03162: Putative tyrosine phosphatase family Length = 257 Score = 29.5 bits (63), Expect = 0.87 Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 4 LSLLRTAQNHPMLVELKNGETYNGHLVSC 32 L +L +NHP+L+ K G+ G LV C Sbjct: 177 LKVLLDEKNHPLLIHCKRGKHRTGCLVGC 205 >At3g02800.1 68416.m00272 tyrosine specific protein phosphatase family protein contains tyrosine specific protein phosphatases active site, PROSITE:PS00383 Length = 199 Score = 29.1 bits (62), Expect = 1.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 4 LSLLRTAQNHPMLVELKNGETYNGHLVSC 32 L +L +NHP+L+ K G+ G LV C Sbjct: 93 LKVLVDVRNHPILIHCKRGKHRTGCLVGC 121 >At5g16480.1 68418.m01926 tyrosine specific protein phosphatase family protein contains tyrosine specific protein phosphatases active site, PROSITE:PS00383 Length = 204 Score = 28.7 bits (61), Expect = 1.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 4 LSLLRTAQNHPMLVELKNGETYNGHLVSC 32 L +L +NHP+L+ K G+ G LV C Sbjct: 96 LRVLVDVRNHPILIHCKRGKHRTGCLVGC 124 >At5g44980.1 68418.m05516 F-box family protein contains F-box domain Pfam:PF00646 Length = 435 Score = 27.5 bits (58), Expect = 3.5 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 29 LVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPD 73 L SC N N+ L + R+ F +P+C I ST++Y+ I + Sbjct: 336 LESCPNLKNLILEYNVELDREQVDFTNVPQCLI--STLEYVEIKE 378 >At3g18295.1 68416.m02327 expressed protein Length = 216 Score = 27.5 bits (58), Expect = 3.5 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Query: 2 LPLSLLRTAQNHPMLVELKNG-ETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPE 58 L L L+ A N P L L NG + NG +V+ N+ R C GD R+ E Sbjct: 65 LRLDLVYDA-NRPKLSVLGNGGDNNNGDVVAAARPWNLRTRRAACNEPPGDDSTRIIE 121 >At1g08750.3 68414.m00974 GPI-anchor transamidase, putative similar to SP|P49018 GPI-anchor transamidase (EC 3.-.-.-) (GPI transamidase) {Saccharomyces cerevisiae}; contains Pfam profile PF01650: Peptidase C13 family Length = 388 Score = 26.6 bits (56), Expect = 6.1 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Query: 39 NLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDE-VIDMVKEETQVKAR 88 N ++CTSR + M T+K L IPDE +I M+ ++ AR Sbjct: 27 NWAVLVCTSRFWFNYRHMANTLSLYRTVKRLGIPDERIILMLADDMACNAR 77 >At1g08750.2 68414.m00973 GPI-anchor transamidase, putative similar to SP|P49018 GPI-anchor transamidase (EC 3.-.-.-) (GPI transamidase) {Saccharomyces cerevisiae}; contains Pfam profile PF01650: Peptidase C13 family Length = 388 Score = 26.6 bits (56), Expect = 6.1 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Query: 39 NLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDE-VIDMVKEETQVKAR 88 N ++CTSR + M T+K L IPDE +I M+ ++ AR Sbjct: 27 NWAVLVCTSRFWFNYRHMANTLSLYRTVKRLGIPDERIILMLADDMACNAR 77 >At1g08750.1 68414.m00972 GPI-anchor transamidase, putative similar to SP|P49018 GPI-anchor transamidase (EC 3.-.-.-) (GPI transamidase) {Saccharomyces cerevisiae}; contains Pfam profile PF01650: Peptidase C13 family Length = 388 Score = 26.6 bits (56), Expect = 6.1 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Query: 39 NLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDE-VIDMVKEETQVKAR 88 N ++CTSR + M T+K L IPDE +I M+ ++ AR Sbjct: 27 NWAVLVCTSRFWFNYRHMANTLSLYRTVKRLGIPDERIILMLADDMACNAR 77 >At4g18372.1 68417.m02725 small nuclear ribonucleoprotein-related / snRNP-related contains similarity to snRNP-associated polypeptide N [Rattus norvegicus] GP|206694|gb|AAA42059 Length = 112 Score = 26.2 bits (55), Expect = 8.1 Identities = 14/42 (33%), Positives = 22/42 (52%) Query: 3 PLSLLRTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVI 44 P+S LR MLV +K+G + G+ D NI L++ + Sbjct: 23 PISRLRKLLFRQMLVGIKDGRFFLGNFHCIDKQGNIILQDTV 64 >At1g78760.1 68414.m09179 F-box family protein contains F-box domain Pfam:PF00646 Length = 452 Score = 26.2 bits (55), Expect = 8.1 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Query: 29 LVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRI 71 L SC N ++ + + DGD+ +P C+ +T++Y++I Sbjct: 342 LQSCPNVKSLVVEFKDSSKEDGDRVLSIPRCFF--TTLEYVKI 382 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,766,384 Number of Sequences: 28952 Number of extensions: 103075 Number of successful extensions: 226 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 208 Number of HSP's gapped (non-prelim): 21 length of query: 139 length of database: 12,070,560 effective HSP length: 74 effective length of query: 65 effective length of database: 9,928,112 effective search space: 645327280 effective search space used: 645327280 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -