BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001819-TA|BGIBMGA001819-PA|undefined (188 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposa... 23 4.4 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.7 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 7.7 >AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposase protein. Length = 336 Score = 23.4 bits (48), Expect = 4.4 Identities = 11/44 (25%), Positives = 22/44 (50%) Query: 69 KLTTLLRDSPNICHPEFGTKWGWSKLTGKFESYKEIIKFYKLEK 112 K+ ++ +PN+ + K+G + T + +E IK Y+ K Sbjct: 68 KILKTIKGNPNLSDRDLARKFGATHSTVRRTRLREGIKSYRASK 111 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 7.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 66 KEKKLTTLLRDSPNICHPEFGTK 88 +EK T +P++CH GTK Sbjct: 2321 REKSFLTTDCTNPSLCHGREGTK 2343 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.6 bits (46), Expect = 7.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 66 KEKKLTTLLRDSPNICHPEFGTK 88 +EK T +P++CH GTK Sbjct: 2331 REKSFLTTDCTNPSLCHGREGTK 2353 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.323 0.140 0.430 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,562 Number of Sequences: 2123 Number of extensions: 7671 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 3 length of query: 188 length of database: 516,269 effective HSP length: 60 effective length of query: 128 effective length of database: 388,889 effective search space: 49777792 effective search space used: 49777792 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -