BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001807-TA|BGIBMGA001807-PA|IPR001506|Peptidase M12A, astacin (413 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 3.0 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 7.0 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.4 bits (48), Expect = 3.0 Identities = 14/62 (22%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Query: 24 VVHYAINNKDYDLHSQDIIISTLTDIQKEICVKFFNTPSNYNISDGKILYINNQDRRKTC 83 +V +A +D ++ I+ L E+ + F Y++ IL++NNQ + Sbjct: 369 IVEFAKRLPGFDKLLREDQIALLKACSSEVMM--FRMARRYDVQTDSILFVNNQPYSRDS 426 Query: 84 QN 85 N Sbjct: 427 YN 428 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 7.0 Identities = 10/34 (29%), Positives = 15/34 (44%) Query: 329 SPPSATLTDQDGVYTAYSFDSATHAPANFMSEDC 362 +PP AT + A + + H PA + DC Sbjct: 33 APPPATTSSGSPASVASNASAPLHIPAKRAAYDC 66 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.134 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,603 Number of Sequences: 317 Number of extensions: 4359 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 413 length of database: 114,650 effective HSP length: 58 effective length of query: 355 effective length of database: 96,264 effective search space: 34173720 effective search space used: 34173720 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -