BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001807-TA|BGIBMGA001807-PA|IPR001506|Peptidase M12A, astacin (413 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 25 5.0 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 6.6 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 8.7 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 24.6 bits (51), Expect = 5.0 Identities = 9/25 (36%), Positives = 12/25 (48%) Query: 247 PKNLLWFSTEGNDMPALGFMEGNQT 271 P + W D+P F+ GNQT Sbjct: 1096 PLYMAWLEALSRDLPPFLFVRGNQT 1120 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.2 bits (50), Expect = 6.6 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 40 DIIISTLTDIQKEICVKFFNTPSNYNISDGKIL 72 +++ +T I++ I FN PS +SDG+ L Sbjct: 2472 NVVRATHKGIERIIYDPLFNRPSKIMLSDGRYL 2504 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 8.7 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 40 DIIISTLTDIQKEICVKFFNTPSNYNISDGKIL 72 +++ +T I++ + FN PS +SDG+ L Sbjct: 2473 NVVRATHKGIERIVYDPLFNRPSKIMLSDGRYL 2505 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.321 0.134 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 436,432 Number of Sequences: 2123 Number of extensions: 17717 Number of successful extensions: 78 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 75 Number of HSP's gapped (non-prelim): 3 length of query: 413 length of database: 516,269 effective HSP length: 66 effective length of query: 347 effective length of database: 376,151 effective search space: 130524397 effective search space used: 130524397 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -