BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001805-TA|BGIBMGA001805-PA|undefined (343 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 26 1.8 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 24 7.1 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 25.8 bits (54), Expect = 1.8 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Query: 25 NSTSADSA-LKKGEEEEEFRVLDILKKRDKMQRRVVKRTDVQPDRID 70 +S+ DS L GE R+L+ + + QR+ KR+D PDR + Sbjct: 998 SSSVLDSMDLINGERASIARLLEEHEPEAEPQRKATKRSDSGPDRTE 1044 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.8 bits (49), Expect = 7.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 252 EKEKTEDDMEYYDWDNN 268 E + T++ ME+YDW N Sbjct: 145 EGDPTDNCMEFYDWIQN 161 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.316 0.133 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 372,511 Number of Sequences: 2123 Number of extensions: 16195 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 30 Number of HSP's gapped (non-prelim): 2 length of query: 343 length of database: 516,269 effective HSP length: 64 effective length of query: 279 effective length of database: 380,397 effective search space: 106130763 effective search space used: 106130763 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -