BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001797-TA|BGIBMGA001797-PA|IPR002737|Protein of unknown function DUF52 (304 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 22 4.9 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 8.5 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/23 (39%), Positives = 17/23 (73%) Query: 254 IGVLLQAISKLSSQSNAPKMSLK 276 IG + +++KL +SN PK++L+ Sbjct: 295 IGEIKYSVNKLIFRSNDPKVTLE 317 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.4 bits (43), Expect = 8.5 Identities = 13/41 (31%), Positives = 16/41 (39%), Gaps = 9/41 (21%) Query: 170 KEAKYGAILAPYLA---------DPQNLLVISSDFCHWGSR 201 K KYG L PYL+ D + +C W SR Sbjct: 114 KVVKYGQTLGPYLSSYVLMATAIDRHQAICYPLTYCSWTSR 154 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,669 Number of Sequences: 317 Number of extensions: 2587 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 304 length of database: 114,650 effective HSP length: 57 effective length of query: 247 effective length of database: 96,581 effective search space: 23855507 effective search space used: 23855507 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -