BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001792-TA|BGIBMGA001792-PA|undefined (141 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45700.1 68415.m05682 sterile alpha motif (SAM) domain-contai... 60 6e-10 At1g19025.1 68414.m02368 DNA cross-link repair protein-related c... 55 2e-08 At1g27410.1 68414.m03341 DNA cross-link repair protein-related c... 54 4e-08 At3g26680.2 68416.m03336 DNA cross-link repair protein-related c... 51 3e-07 At3g26680.1 68416.m03335 DNA cross-link repair protein-related c... 51 3e-07 At1g66730.1 68414.m07585 ATP dependent DNA ligase family protein... 39 0.001 At2g01730.1 68415.m00101 metallo-beta-lactamase family protein s... 38 0.002 At1g61010.2 68414.m06870 cleavage and polyadenylation specificit... 35 0.024 At1g61010.1 68414.m06869 cleavage and polyadenylation specificit... 35 0.024 At3g19970.1 68416.m02527 expressed protein 31 0.29 At5g13940.1 68418.m01630 hypothetical protein 29 1.2 At2g13290.2 68415.m01465 glycosyl transferase family 17 protein ... 29 1.6 At2g13290.1 68415.m01464 glycosyl transferase family 17 protein ... 29 1.6 At3g16470.1 68416.m02101 jacalin lectin family protein contains ... 28 2.1 At4g03500.1 68417.m00477 ankyrin repeat family protein contains ... 27 4.8 At5g28080.1 68418.m03391 protein kinase family protein contains ... 26 8.4 At4g33150.2 68417.m04723 lysine-ketoglutarate reductase/saccharo... 26 8.4 At4g33150.1 68417.m04722 lysine-ketoglutarate reductase/saccharo... 26 8.4 At3g54070.1 68416.m05978 ankyrin repeat family protein contains ... 26 8.4 >At2g45700.1 68415.m05682 sterile alpha motif (SAM) domain-containing protein similar to SNM1 protein [Mus musculus] GI:7595835; contains Pfam profile PF00536: SAM domain (Sterile alpha motif) Length = 723 Score = 60.1 bits (139), Expect = 6e-10 Identities = 43/132 (32%), Positives = 68/132 (51%), Gaps = 11/132 (8%) Query: 9 LNVKTIPAGHCLGSVMFLFE-INNQTILYTGDFRMNPENISAFGQLHKDNMPIKINTIYL 67 ++V A HC GS+M LFE N + +L+TGDFR + E + H I+++ L Sbjct: 475 IDVTCFDANHCPGSIMILFEPANGKAVLHTGDFRYSEEMSNWLIGSH-------ISSLIL 527 Query: 68 DTTFQNESFDNFPRRKDSIRMLVNHIKQWVDGEPTNRIALHTSARYGYEFVFNEIYNILN 127 DTT+ N +D FP+++ I+ +V I+ T + L S G E +F E+ +L Sbjct: 528 DTTYCNPQYD-FPKQEAVIQFVVEAIQAEAFNPKT--LFLIGSYTIGKERLFLEVARVLR 584 Query: 128 MKTYVSDDKWAL 139 K Y++ K L Sbjct: 585 EKIYINPAKLKL 596 >At1g19025.1 68414.m02368 DNA cross-link repair protein-related contains weak similarity to Swiss-Prot:P30620 DNA cross-LINK repair protein PSO2/SNM1 [Saccharomyces cerevisiae] Length = 549 Score = 54.8 bits (126), Expect = 2e-08 Identities = 42/138 (30%), Positives = 61/138 (44%), Gaps = 11/138 (7%) Query: 1 MDDGSHKYLNVKTIPAGHCLGSVMFLFEINNQTILYTGDFRMNPENISAF-----GQLHK 55 +DD ++ V A HC G+VMFLFE + IL+TGD R+ + + + G+ H Sbjct: 85 VDDPDGEF-KVTAFDANHCPGAVMFLFEGSFGNILHTGDCRLTLDCLHSLPEKYVGRSHG 143 Query: 56 DNMPIKINTIYLDTTFQNESF-DNFPRRKDSIRMLVNHIKQWVDGEPTNRIALHTSARYG 114 + I+LD TF S FP + +IR ++N I W P + G Sbjct: 144 MKPKCSLGYIFLDCTFGKSSHSQRFPTKHSAIRQIINCI--W--NHPDAPVVYLACDMLG 199 Query: 115 YEFVFNEIYNILNMKTYV 132 E V E+ K YV Sbjct: 200 QEDVLLEVSRTFGSKIYV 217 >At1g27410.1 68414.m03341 DNA cross-link repair protein-related contains weak similarity to Swiss-Prot:P30620 DNA cross-LINK repair protein PSO2/SNM1 [Saccharomyces cerevisiae] Length = 422 Score = 54.0 bits (124), Expect = 4e-08 Identities = 40/130 (30%), Positives = 67/130 (51%), Gaps = 7/130 (5%) Query: 4 GSHKYLNVKTIPAGHCLGSVMFLFEINNQTILYTGDFRMNPE-NISAFGQLHKDNMPIKI 62 GS L++ I A HC GS+MFLF + LYTGDFR + + + A L + Sbjct: 81 GSTVRLHLMAIDAHHCPGSIMFLFRGDFGCFLYTGDFRWDSDASDEARTTLVAAIDEFPV 140 Query: 63 NTIYLDTTFQNESFDNFPRRKDSIRMLVNHIKQWVDGEPTNRIALHTSARYGYEFVFNEI 122 + +YLD T+ N + +FP R +++++ + I P++ I + + G E + + Sbjct: 141 DILYLDNTYCNPIY-SFPSRLVAVQLVADIIA----SHPSHDIIIAVDS-LGKEDLLVHV 194 Query: 123 YNILNMKTYV 132 ILN+K +V Sbjct: 195 SRILNIKIWV 204 >At3g26680.2 68416.m03336 DNA cross-link repair protein-related contains weak similarity to Swiss-Prot:P30620 DNA cross-LINK repair protein PSO2/SNM1 [Saccharomyces cerevisiae] Length = 484 Score = 51.2 bits (117), Expect = 3e-07 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 8/126 (6%) Query: 9 LNVKTIPAGHCLGSVMFLFEINNQTI-LYTGDFRMNPENISAFGQLHKDNMPIKINTIYL 67 + V I A HC G+ + F + + T L+TGDFR + + Q H +++ +YL Sbjct: 229 IKVTLIEANHCPGAALIHFRLLDGTCYLHTGDFRASKQM-----QTHPLLFNQRVHVLYL 283 Query: 68 DTTFQNESFDNFPRRKDSIRMLVNHIKQWVDGEPTNRIALHTSARYGYEFVFNEIYNILN 127 DTT+ N + FP ++D + +V K ++ +P I + S G E V+ I L Sbjct: 284 DTTYCNPRY-KFPSKEDVLSYVVRITKDFLRKQPKTLIVV-GSYSIGKECVYLAIAKALG 341 Query: 128 MKTYVS 133 +K + + Sbjct: 342 VKIFAN 347 >At3g26680.1 68416.m03335 DNA cross-link repair protein-related contains weak similarity to Swiss-Prot:P30620 DNA cross-LINK repair protein PSO2/SNM1 [Saccharomyces cerevisiae] Length = 484 Score = 51.2 bits (117), Expect = 3e-07 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 8/126 (6%) Query: 9 LNVKTIPAGHCLGSVMFLFEINNQTI-LYTGDFRMNPENISAFGQLHKDNMPIKINTIYL 67 + V I A HC G+ + F + + T L+TGDFR + + Q H +++ +YL Sbjct: 229 IKVTLIEANHCPGAALIHFRLLDGTCYLHTGDFRASKQM-----QTHPLLFNQRVHVLYL 283 Query: 68 DTTFQNESFDNFPRRKDSIRMLVNHIKQWVDGEPTNRIALHTSARYGYEFVFNEIYNILN 127 DTT+ N + FP ++D + +V K ++ +P I + S G E V+ I L Sbjct: 284 DTTYCNPRY-KFPSKEDVLSYVVRITKDFLRKQPKTLIVV-GSYSIGKECVYLAIAKALG 341 Query: 128 MKTYVS 133 +K + + Sbjct: 342 VKIFAN 347 >At1g66730.1 68414.m07585 ATP dependent DNA ligase family protein contains Pfam profile: PF01068 ATP dependent DNA ligase domain Length = 1417 Score = 38.7 bits (86), Expect = 0.001 Identities = 29/88 (32%), Positives = 47/88 (53%), Gaps = 10/88 (11%) Query: 11 VKTIPAGHCLGSVMFLFEINNQT-----ILYTGDFRMNPENISAFGQLHKDNMPIKINTI 65 V I A HC G+V FLF++ ++ ++TGDFR E F N + + + Sbjct: 140 VVLIEANHCPGAVQFLFKVKLESSGFEKYVHTGDFRFCDE--MRFDPFL--NGFVGCDGV 195 Query: 66 YLDTTFQNESFDNFPRRKDSIRMLVNHI 93 +LDTT+ N F FP +++S+ +V+ I Sbjct: 196 FLDTTYCNPKF-VFPSQEESVGYVVSVI 222 >At2g01730.1 68415.m00101 metallo-beta-lactamase family protein simliar to SP|P79101 Cleavage and polyadenylation specificity factor, 73 kDa subunit (CPSF 73 kDa subunit) {Bos taurus}; contains Pfam profile PF00753: Metallo-beta-lactamase superfamily Length = 613 Score = 38.3 bits (85), Expect = 0.002 Identities = 19/79 (24%), Positives = 40/79 (50%), Gaps = 3/79 (3%) Query: 9 LNVKTIPAGHCLGSVMFLFEINNQTILYTGDFRMNPENISAFGQLHKDNMPIKINTIYLD 68 L ++ AGH LG+VM ++ + I+YTGD+ M + ++ + + + I+ Sbjct: 147 LQIRAYYAGHVLGAVMVYAKMGDAAIVYTGDYNMTTDRHLGAAKIDRLQLDLLISESTYA 206 Query: 69 TTFQNESFDNFPRRKDSIR 87 TT + +PR ++ ++ Sbjct: 207 TTIRG---SKYPREREFLQ 222 >At1g61010.2 68414.m06870 cleavage and polyadenylation specificity factor, putative similar to cleavage and polyadenylation specificity factor 73 kDa subunit [Homo sapiens] SWISS-PROT:Q9UKF6 Length = 693 Score = 34.7 bits (76), Expect = 0.024 Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 16 AGHCLGSVMFLFEINNQTILYTGDF 40 AGH LG+ MF+ +I ILYTGD+ Sbjct: 166 AGHVLGAAMFMVDIAGVRILYTGDY 190 >At1g61010.1 68414.m06869 cleavage and polyadenylation specificity factor, putative similar to cleavage and polyadenylation specificity factor 73 kDa subunit [Homo sapiens] SWISS-PROT:Q9UKF6 Length = 693 Score = 34.7 bits (76), Expect = 0.024 Identities = 14/25 (56%), Positives = 18/25 (72%) Query: 16 AGHCLGSVMFLFEINNQTILYTGDF 40 AGH LG+ MF+ +I ILYTGD+ Sbjct: 166 AGHVLGAAMFMVDIAGVRILYTGDY 190 >At3g19970.1 68416.m02527 expressed protein Length = 434 Score = 31.1 bits (67), Expect = 0.29 Identities = 11/35 (31%), Positives = 19/35 (54%) Query: 81 RRKDSIRMLVNHIKQWVDGEPTNRIALHTSARYGY 115 + + +I LVNH+ W+D E + HT + G+ Sbjct: 210 KAEKNIESLVNHLADWLDEEQKKNLVFHTFSNTGW 244 >At5g13940.1 68418.m01630 hypothetical protein Length = 395 Score = 29.1 bits (62), Expect = 1.2 Identities = 21/71 (29%), Positives = 29/71 (40%), Gaps = 4/71 (5%) Query: 43 NPENISAFGQLHKDNMPIKINTIYLDTTFQNESFDNFPRRKDSIRMLVNHIKQWVDGEPT 102 N E A ++ N+PI +N LDT F FPR D + + K WV Sbjct: 11 NEEIQVALSAQYRLNLPIVVNEAKLDTKLLTRYFSKFPR--DDLPHFAD--KTWVWDRSY 66 Query: 103 NRIALHTSARY 113 + L + RY Sbjct: 67 ESLLLPSQNRY 77 >At2g13290.2 68415.m01465 glycosyl transferase family 17 protein low similarity to beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC 2.4.1.144) from Mus musculus [SP|Q10470], Rattus norvegicus [SP|Q02527], Homo sapiens [SP|Q09327] ; contains Pfam profile PF04724 :Glycosyltransferase family 17 Length = 361 Score = 28.7 bits (61), Expect = 1.6 Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Query: 95 QWVDGEPTNRIALHTSAR-YGYEFVFNEIYNILNMKTYVSDDKWALYR 141 QW DG P +H R Y Y F F Y+ ++ KW YR Sbjct: 205 QWCDGIPD---VMHLEMREYMYSFEFPVDYSSWRASVHIYSRKWTQYR 249 >At2g13290.1 68415.m01464 glycosyl transferase family 17 protein low similarity to beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC 2.4.1.144) from Mus musculus [SP|Q10470], Rattus norvegicus [SP|Q02527], Homo sapiens [SP|Q09327] ; contains Pfam profile PF04724 :Glycosyltransferase family 17 Length = 361 Score = 28.7 bits (61), Expect = 1.6 Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Query: 95 QWVDGEPTNRIALHTSAR-YGYEFVFNEIYNILNMKTYVSDDKWALYR 141 QW DG P +H R Y Y F F Y+ ++ KW YR Sbjct: 205 QWCDGIPD---VMHLEMREYMYSFEFPVDYSSWRASVHIYSRKWTQYR 249 >At3g16470.1 68416.m02101 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767 Length = 451 Score = 28.3 bits (60), Expect = 2.1 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 4/62 (6%) Query: 21 GSVMFLFEINNQTILYTGDFRMNPENISAFGQLHKDNM---PIKINTIYLDTTFQNESFD 77 G ++ L E QT+L T +F ++PE+ + +++ + + PI+I T + TF+ ++ Sbjct: 202 GKIVSL-EHGKQTLLGTEEFEIDPEDYITYVKVYYEKLFGSPIEIVTALIFKTFKGKTSQ 260 Query: 78 NF 79 F Sbjct: 261 PF 262 >At4g03500.1 68417.m00477 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 652 Score = 27.1 bits (57), Expect = 4.8 Identities = 16/54 (29%), Positives = 26/54 (48%) Query: 82 RKDSIRMLVNHIKQWVDGEPTNRIALHTSARYGYEFVFNEIYNILNMKTYVSDD 135 RKD + L++ ++ R +L A GY F+ +++ K YVSDD Sbjct: 259 RKDILDALLSKDASLINLRDEGRTSLSFGASIGYYQGFSYLFDKNRDKVYVSDD 312 >At5g28080.1 68418.m03391 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 406 Score = 26.2 bits (55), Expect = 8.4 Identities = 10/34 (29%), Positives = 19/34 (55%) Query: 2 DDGSHKYLNVKTIPAGHCLGSVMFLFEINNQTIL 35 D+G +L +KT+ C+ ++ F F+I T + Sbjct: 286 DNGDGLFLRLKTVNKEGCVRNIYFPFDIETDTAI 319 >At4g33150.2 68417.m04723 lysine-ketoglutarate reductase/saccharopine dehydrogenase bifunctional enzyme identical to lysine-ketoglutarate reductase/saccharopine dehydrogenase GI:2052508 from [Arabidopsis thaliana] Length = 1064 Score = 26.2 bits (55), Expect = 8.4 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Query: 21 GSVMFLFEINNQTILYTGDFRMNPENISAFGQLHKDNMPIKINTIYLDTTFQNESFDNF 79 GS+ F +N T++ + FR NP N S + + D + + + L T F E+ +F Sbjct: 356 GSIEF---VNRATLIDSPFFRFNPSNNSYYDDMDGDGV-LCMAVDILPTEFAKEASQHF 410 >At4g33150.1 68417.m04722 lysine-ketoglutarate reductase/saccharopine dehydrogenase bifunctional enzyme identical to lysine-ketoglutarate reductase/saccharopine dehydrogenase GI:2052508 from [Arabidopsis thaliana] Length = 1064 Score = 26.2 bits (55), Expect = 8.4 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Query: 21 GSVMFLFEINNQTILYTGDFRMNPENISAFGQLHKDNMPIKINTIYLDTTFQNESFDNF 79 GS+ F +N T++ + FR NP N S + + D + + + L T F E+ +F Sbjct: 356 GSIEF---VNRATLIDSPFFRFNPSNNSYYDDMDGDGV-LCMAVDILPTEFAKEASQHF 410 >At3g54070.1 68416.m05978 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 574 Score = 26.2 bits (55), Expect = 8.4 Identities = 11/34 (32%), Positives = 19/34 (55%) Query: 103 NRIALHTSARYGYEFVFNEIYNILNMKTYVSDDK 136 NR H +A Y +E +F+ IY + +K ++ K Sbjct: 289 NRTLFHVAALYRHENIFSLIYELGGIKDLIASYK 322 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.322 0.138 0.426 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,593,205 Number of Sequences: 28952 Number of extensions: 141564 Number of successful extensions: 235 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 223 Number of HSP's gapped (non-prelim): 19 length of query: 141 length of database: 12,070,560 effective HSP length: 74 effective length of query: 67 effective length of database: 9,928,112 effective search space: 665183504 effective search space used: 665183504 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -