BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001770-TA|BGIBMGA001770-PA|undefined (1503 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 24 6.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 6.8 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 24.2 bits (50), Expect = 6.8 Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 1405 GKVNPNAMEQIRLQQLKQHAQHPPAQQSKPEPI 1437 G + N I KQH + P A Q+K +P+ Sbjct: 231 GHIEVNHSAPITTCNKKQHLESPSALQAKVDPL 263 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.2 bits (50), Expect = 6.8 Identities = 10/21 (47%), Positives = 12/21 (57%) Query: 1292 GLSSESDNPERKQVTGQPQPV 1312 GL DNP R+ T P+PV Sbjct: 990 GLGLIPDNPSREDCTKPPEPV 1010 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.129 0.368 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 278,047 Number of Sequences: 317 Number of extensions: 10684 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 29 Number of HSP's gapped (non-prelim): 2 length of query: 1503 length of database: 114,650 effective HSP length: 66 effective length of query: 1437 effective length of database: 93,728 effective search space: 134687136 effective search space used: 134687136 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -