BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001763-TA|BGIBMGA001763-PA|undefined (379 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 3.6 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 4.8 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Query: 358 DSDLRRHLKRILDWT 372 D DL H+ ILDWT Sbjct: 209 DYDLSSHVITILDWT 223 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.6 bits (46), Expect = 4.8 Identities = 17/71 (23%), Positives = 30/71 (42%), Gaps = 3/71 (4%) Query: 179 EIASRTFDVTEFLVQQDNMQIKKEQDEAFDLKVNESNTDDFYSDNAIDFATYFAARSEKI 238 E+ +T V N KK + D ++++ D +N + T + K+ Sbjct: 242 ELIRQTHKSPSHSVDNSNSSEKKSSIQHGD-DAHKTHHLDKNPENTL--GTMLSIHPSKL 298 Query: 239 EVEEPNLYHQN 249 +VE+ NL H N Sbjct: 299 DVEQMNLLHSN 309 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.132 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,234 Number of Sequences: 317 Number of extensions: 2940 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 379 length of database: 114,650 effective HSP length: 58 effective length of query: 321 effective length of database: 96,264 effective search space: 30900744 effective search space used: 30900744 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -