BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001759-TA|BGIBMGA001759-PA|undefined (412 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 26 0.57 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 24 2.3 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 22 7.0 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 9.2 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 25.8 bits (54), Expect = 0.57 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Query: 323 YIISMELVHTKEV-DIDKLVSVLESIPTKMMGSK 355 Y +S+ ++H ++ DID L S +ES P K + SK Sbjct: 125 YALSVAILHRQDTQDID-LPSFIESFPDKYVDSK 157 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 23.8 bits (49), Expect = 2.3 Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 283 LGQIREKYKRMLETYRDARDRYTNRTL 309 L QIR+ Y + LE Y A + +T + Sbjct: 151 LAQIRQIYHQELEKYEQACNEFTTHVM 177 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 22.2 bits (45), Expect = 7.0 Identities = 9/39 (23%), Positives = 23/39 (58%) Query: 248 KLSLELLQDSKLKLRQIRDIVDEHSVVVAFQIGYILGQI 286 K+S+ L++D+ + R + D V + + + + ++ G+I Sbjct: 147 KISVGLIRDTAVLYRLLADNVANFNKIFGWSLIFLFGRI 185 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.8 bits (44), Expect = 9.2 Identities = 11/49 (22%), Positives = 25/49 (51%) Query: 264 IRDIVDEHSVVVAFQIGYILGQIREKYKRMLETYRDARDRYTNRTLLAG 312 ++D+++ ++ +G L Q+ + +K +LE + + RY L G Sbjct: 370 LKDVIEIVDKLLNPDLGLSLLQVAQIFKNLLENHYEEFVRYELGELAPG 418 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,759 Number of Sequences: 317 Number of extensions: 3709 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 4 length of query: 412 length of database: 114,650 effective HSP length: 58 effective length of query: 354 effective length of database: 96,264 effective search space: 34077456 effective search space used: 34077456 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -