BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001755-TA|BGIBMGA001755-PA|IPR007123|Gelsolin region, IPR007122|Gelsolin (353 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 2.5 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 23 2.5 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 5.8 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 5.8 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 5.8 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 5.8 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 5.8 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 5.8 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 5.8 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 5.8 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 5.8 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 7.7 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 23.4 bits (48), Expect = 2.5 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Query: 284 VTPLSKPFKQENLSPQEKSQAMTKAQEL--LNAKNYPSWVQVTRVLQNTEPAAFKQYF 339 + PL+K K NL E + ++ K QEL L+ K V+++ + + T A +F Sbjct: 233 IFPLTKAEKVRNLKEDEVTFSVQKIQELSHLHYKLANFTVKISGLFEITTITAMVMWF 290 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 23.4 bits (48), Expect = 2.5 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Query: 284 VTPLSKPFKQENLSPQEKSQAMTKAQEL--LNAKNYPSWVQVTRVLQNTEPAAFKQYF 339 + PL+K K NL E + ++ K QEL L+ K V+++ + + T A +F Sbjct: 189 IFPLTKAEKVRNLKEDEVTFSVQKIQELSHLHYKLANFTVKISGLFEITTITAMVMWF 246 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.2 bits (45), Expect = 5.8 Identities = 8/14 (57%), Positives = 9/14 (64%) Query: 61 WRIQTTSDNRNNLS 74 WR +DNRNN S Sbjct: 388 WRKNNPNDNRNNTS 401 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 20 TATKPQEISGPITSLSDKNARDKA 43 T+T Q +S P +S S ++ +KA Sbjct: 159 TSTTSQNLSSPASSTSSTSSTEKA 182 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 20 TATKPQEISGPITSLSDKNARDKA 43 T+T Q +S P +S S ++ +KA Sbjct: 159 TSTASQNLSSPASSTSSTSSTEKA 182 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 20 TATKPQEISGPITSLSDKNARDKA 43 T+T Q +S P +S S ++ +KA Sbjct: 159 TSTASQNLSSPASSTSSTSSTEKA 182 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 20 TATKPQEISGPITSLSDKNARDKA 43 T+T Q +S P +S S ++ +KA Sbjct: 159 TSTASQNLSSPASSTSSTSSTEKA 182 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 20 TATKPQEISGPITSLSDKNARDKA 43 T+T Q +S P +S S ++ +KA Sbjct: 159 TSTASQNLSSPASSTSSTSSTEKA 182 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 20 TATKPQEISGPITSLSDKNARDKA 43 T+T Q +S P +S S ++ +KA Sbjct: 115 TSTASQNLSSPASSTSSTSSTEKA 138 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 20 TATKPQEISGPITSLSDKNARDKA 43 T+T Q +S P +S S ++ +KA Sbjct: 159 TSTASQNLSSPASSTSSTSSTEKA 182 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 20 TATKPQEISGPITSLSDKNARDKA 43 T+T Q +S P +S S ++ +KA Sbjct: 159 TSTASQNLSSPASSTSSTSSTEKA 182 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.8 bits (44), Expect = 7.7 Identities = 11/19 (57%), Positives = 13/19 (68%), Gaps = 2/19 (10%) Query: 56 AGVQIWRIQTTSDNRNNLS 74 AGV IW I+T D+ N LS Sbjct: 356 AGVMIWSIET--DDFNGLS 372 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.132 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,435 Number of Sequences: 317 Number of extensions: 3558 Number of successful extensions: 21 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 12 length of query: 353 length of database: 114,650 effective HSP length: 57 effective length of query: 296 effective length of database: 96,581 effective search space: 28587976 effective search space used: 28587976 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -