BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001748-TA|BGIBMGA001748-PA|IPR007205|Protein of unknown function DUF383, IPR007206|Protein of unknown function DUF384 (361 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 4.3 AF117752-1|AAD38338.1| 155|Anopheles gambiae serine protease 2A... 23 9.9 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 4.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 61 KEIAKHALLMLVNISAYTRGATELLKYKPLR 91 K+ KH+LL L N+ +GA LK P + Sbjct: 858 KDFRKHSLLPLNNVFDRIKGALPHLKKSPTK 888 >AF117752-1|AAD38338.1| 155|Anopheles gambiae serine protease 2A protein. Length = 155 Score = 23.4 bits (48), Expect = 9.9 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 112 DAACMTL-SNITRLEDELEVCLNTFIPHLNDIMNAFV 147 D A + L +N+T +D +CLNT P + +N V Sbjct: 49 DIALIELKNNVTYKQDVGPICLNTDRPEIGPSINLTV 85 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.320 0.139 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 385,696 Number of Sequences: 2123 Number of extensions: 16475 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 19 Number of HSP's gapped (non-prelim): 2 length of query: 361 length of database: 516,269 effective HSP length: 65 effective length of query: 296 effective length of database: 378,274 effective search space: 111969104 effective search space used: 111969104 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -