BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001745-TA|BGIBMGA001745-PA|IPR001254|Peptidase S1 and S6, chymotrypsin/Hap, IPR009003|Peptidase, trypsin-like serine and cysteine (306 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 25 0.70 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 24 1.2 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 25.0 bits (52), Expect = 0.70 Identities = 12/47 (25%), Positives = 20/47 (42%) Query: 244 GKDTCQGDSGSPLQVASKDNQCIFHVVGVTSFGRRCAESGYPAIYTR 290 G C + G PL+ + ++ F + + + YP IYTR Sbjct: 204 GVSDCDSEPGIPLKRKQRRSRTTFTAHQLDELEKAFERTQYPDIYTR 250 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 24.2 bits (50), Expect = 1.2 Identities = 17/65 (26%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Query: 228 WQGFAATQMCAGELRGGKDTCQGDSGSPLQVASKDNQCIFHVVGVTSFGRRC-----AES 282 W G A Q+C G L + T D + K C G G+ C + Sbjct: 119 WNGTATEQLCIGGLLYNERTHSCDWPENVDGCQKHPLCNDDPNGNVPLGKSCNRYWQCQG 178 Query: 283 GYPAI 287 GYP + Sbjct: 179 GYPRL 183 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.135 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,779 Number of Sequences: 317 Number of extensions: 2911 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 306 length of database: 114,650 effective HSP length: 57 effective length of query: 249 effective length of database: 96,581 effective search space: 24048669 effective search space used: 24048669 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -