BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001728-TA|BGIBMGA001728-PA|IPR011013|Galactose mutarotase-like, IPR011682|Glycosyl hydrolases 38, C-terminal (673 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 4.9 AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 25 8.6 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.4 bits (53), Expect = 4.9 Identities = 9/28 (32%), Positives = 16/28 (57%) Query: 587 IRSIAECALGGNVWLKDWSPLRWNKKTE 614 I +I +G + + W+PL WN K++ Sbjct: 2734 IMAIIGAYIGASAAAQSWNPLEWNWKSK 2761 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 24.6 bits (51), Expect = 8.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Query: 538 LPLGIHLLSIEQWNEATVLIRLENYLEKSDAIRSGIKRVYLRDV 581 L LG+ +S Q AT ++ Y + S+A+R G+ +V + D+ Sbjct: 12 LVLGMLEVSSVQGQNATTGPKVLCYYDGSNALREGLGKVTVSDI 55 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.136 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,753 Number of Sequences: 2123 Number of extensions: 27020 Number of successful extensions: 50 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 46 Number of HSP's gapped (non-prelim): 4 length of query: 673 length of database: 516,269 effective HSP length: 69 effective length of query: 604 effective length of database: 369,782 effective search space: 223348328 effective search space used: 223348328 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -