BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001708-TA|BGIBMGA001708-PA|undefined (328 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 26 0.43 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 26 0.43 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 26 0.43 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 26 0.43 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 25.8 bits (54), Expect = 0.43 Identities = 17/68 (25%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Query: 129 KDKSAAEGTLKVLDGRDPDYQRLAVKGLIGRAKRVLTCTRDETKVSN-IKEAITVFEKFL 187 +D+SA K L DPDY A + DET+V+ +K + ++ Sbjct: 589 EDQSARRVAQKYLRVVDPDYYEFETHIFFDDAFEISDHNDDETQVNRFVKLLVATIDEAA 648 Query: 188 DDFESLHL 195 D H+ Sbjct: 649 SDVHQTHM 656 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 25.8 bits (54), Expect = 0.43 Identities = 17/68 (25%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Query: 129 KDKSAAEGTLKVLDGRDPDYQRLAVKGLIGRAKRVLTCTRDETKVSN-IKEAITVFEKFL 187 +D+SA K L DPDY A + DET+V+ +K + ++ Sbjct: 589 EDQSARRVAQKYLRVVDPDYYEFETHIFFDDAFEISDHNDDETQVNRFVKLLVATIDEAA 648 Query: 188 DDFESLHL 195 D H+ Sbjct: 649 SDVHQTHM 656 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 25.8 bits (54), Expect = 0.43 Identities = 17/68 (25%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Query: 129 KDKSAAEGTLKVLDGRDPDYQRLAVKGLIGRAKRVLTCTRDETKVSN-IKEAITVFEKFL 187 +D+SA K L DPDY A + DET+V+ +K + ++ Sbjct: 589 EDQSARRVAQKYLRVVDPDYYEFETHIFFDDAFEISDHNDDETQVNRFVKLLVATIDEAA 648 Query: 188 DDFESLHL 195 D H+ Sbjct: 649 SDVHQTHM 656 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 25.8 bits (54), Expect = 0.43 Identities = 17/68 (25%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Query: 129 KDKSAAEGTLKVLDGRDPDYQRLAVKGLIGRAKRVLTCTRDETKVSN-IKEAITVFEKFL 187 +D+SA K L DPDY A + DET+V+ +K + ++ Sbjct: 589 EDQSARRVAQKYLRVVDPDYYEFETHIFFDDAFEISDHNDDETQVNRFVKLLVATIDEAA 648 Query: 188 DDFESLHL 195 D H+ Sbjct: 649 SDVHQTHM 656 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.131 0.367 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,969 Number of Sequences: 317 Number of extensions: 2226 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 4 length of query: 328 length of database: 114,650 effective HSP length: 57 effective length of query: 271 effective length of database: 96,581 effective search space: 26173451 effective search space used: 26173451 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -