Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001699-TA|BGIBMGA001699-PA|IPR003590|Leucine-rich
repeat, ribonuclease inhibitor subtype, IPR009109|Ran-GTPase
activating protein 1, C-terminal, IPR001611|Leucine-rich repeat
         (542 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    23   7.1  

>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 22.6 bits (46), Expect = 7.1
 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%)

Query: 201 LEEIAMPQNGIYHVGITALSEAFKHNPAL-NHL 232
           L  I +  N I HVG   +   F H P   NHL
Sbjct: 674 LFHIVIGMNLIIHVGTQLIYRPFSHFPRCGNHL 706


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.317    0.134    0.384 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 91,610
Number of Sequences: 317
Number of extensions: 3015
Number of successful extensions: 7
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 7
Number of HSP's gapped (non-prelim): 1
length of query: 542
length of database: 114,650
effective HSP length: 60
effective length of query: 482
effective length of database: 95,630
effective search space: 46093660
effective search space used: 46093660
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 45 (22.2 bits)