BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001699-TA|BGIBMGA001699-PA|IPR003590|Leucine-rich repeat, ribonuclease inhibitor subtype, IPR009109|Ran-GTPase activating protein 1, C-terminal, IPR001611|Leucine-rich repeat (542 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 7.1 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.6 bits (46), Expect = 7.1 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 201 LEEIAMPQNGIYHVGITALSEAFKHNPAL-NHL 232 L I + N I HVG + F H P NHL Sbjct: 674 LFHIVIGMNLIIHVGTQLIYRPFSHFPRCGNHL 706 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.134 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,610 Number of Sequences: 317 Number of extensions: 3015 Number of successful extensions: 7 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 1 length of query: 542 length of database: 114,650 effective HSP length: 60 effective length of query: 482 effective length of database: 95,630 effective search space: 46093660 effective search space used: 46093660 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -