BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001699-TA|BGIBMGA001699-PA|IPR003590|Leucine-rich repeat, ribonuclease inhibitor subtype, IPR009109|Ran-GTPase activating protein 1, C-terminal, IPR001611|Leucine-rich repeat (542 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 27 1.7 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 26 2.2 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 26.6 bits (56), Expect = 1.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Query: 275 LAKAFKGNSLLLEVRNSLGNAANKKSLKDKL 305 L K F+ + + + +RN LG K++K+KL Sbjct: 713 LDKEFEDDRVAITIRNLLGGTDGPKAMKEKL 743 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 26.2 bits (55), Expect = 2.2 Identities = 13/39 (33%), Positives = 19/39 (48%) Query: 6 LNSLNTVLDEPAQPETGVDFSGKSLKLDTAKDAQQIVDA 44 LN LN +++P P+ G T + QQ+VDA Sbjct: 517 LNRLNEYIEDPESPQLSEQQFGFRRGRSTLQAIQQVVDA 555 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.317 0.134 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 425,568 Number of Sequences: 2123 Number of extensions: 14458 Number of successful extensions: 66 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 64 Number of HSP's gapped (non-prelim): 2 length of query: 542 length of database: 516,269 effective HSP length: 67 effective length of query: 475 effective length of database: 374,028 effective search space: 177663300 effective search space used: 177663300 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -