BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001435-TA|BGIBMGA001435-PA|IPR000884|Thrombospondin, type I, IPR010294|ADAM-TS Spacer 1 (476 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 28 0.63 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 25 3.4 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 25 3.4 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 25 3.4 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 25 4.4 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 25 4.4 Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protei... 25 5.9 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 27.9 bits (59), Expect = 0.63 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Query: 348 DKQRLHKKHSYRLSEWTPCSVTC-GVGYTRRY---YECIDQHQRVVEQSQCYHIEP 399 D++R+H+K + L E T + Y YECI Q Q+VV +S I P Sbjct: 1259 DRKRIHRKSYFELRELKRAEKTIIRLVQNEVYATEYECIKQGQQVVRKSPLRVIRP 1314 Score = 25.0 bits (52), Expect = 4.4 Identities = 13/61 (21%), Positives = 24/61 (39%) Query: 102 PEPVNNGNYCIGDRSRYKVCNTDPCPINEPSFREVQCSRHNNMPYKNETIDEWVPYFDQD 161 P+ + +GN C + + T C + E SF C R + + +FD+ Sbjct: 1202 PKNIESGNTCETAKEEKQTKTTLTCMVKEESFINKLCERVGSFTKLKRIVAYCHRFFDRK 1261 Query: 162 K 162 + Sbjct: 1262 R 1262 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 103 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 149 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 103 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 149 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.4 bits (53), Expect = 3.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQDYWDR 160 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 4.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQNYWDR 160 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 4.4 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query: 118 YKVCNTDPCPIN----EPSFREVQCSRHNNMPYKNETIDEWVPYFDQ 160 Y N C +N + S+ E++ ++ + Y+ ET+D+ Y+D+ Sbjct: 114 YVYLNRHACLLNTTSSKDSYHEIEARKYPVLRYRFETMDDLQNYWDR 160 >Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protein precursor protein. Length = 260 Score = 24.6 bits (51), Expect = 5.9 Identities = 15/66 (22%), Positives = 26/66 (39%) Query: 231 ACKTVQGIYTKGTTRQSGFSEVAIIPAGSRNVKIQEKVSPGNYISIGSTKSRRMFLNGAR 290 AC T+ + G + + + P G +V S G G K+R++ L A Sbjct: 6 ACATLLLVVLSGVSAGGKYCSSDLCPRGGPHVGCNPPSSSGGPTCQGKQKARKVLLTPAL 65 Query: 291 NATLTE 296 A + + Sbjct: 66 QAYIMD 71 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.320 0.135 0.458 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 588,818 Number of Sequences: 2123 Number of extensions: 27327 Number of successful extensions: 89 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 41 Number of HSP's gapped (non-prelim): 48 length of query: 476 length of database: 516,269 effective HSP length: 67 effective length of query: 409 effective length of database: 374,028 effective search space: 152977452 effective search space used: 152977452 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -