BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001402-TA|BGIBMGA001402-PA|IPR002086|Aldehyde dehydrogenase (362 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A... 25 3.3 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 10.0 >AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A protein. Length = 433 Score = 25.0 bits (52), Expect = 3.3 Identities = 9/18 (50%), Positives = 14/18 (77%) Query: 51 YGDTGAAIVDHPDVDKVA 68 YGDTGA +H D++++A Sbjct: 322 YGDTGAHCGNHQDLNEIA 339 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.4 bits (48), Expect = 10.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 270 LKFSQFDEVVERANNSEYGLAAAVFTKDLDK 300 LK+S D + N +EY FT++LD+ Sbjct: 725 LKYSMNDLETSKKNINEYDRQLEDFTRELDQ 755 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 344,246 Number of Sequences: 2123 Number of extensions: 13799 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 25 Number of HSP's gapped (non-prelim): 2 length of query: 362 length of database: 516,269 effective HSP length: 65 effective length of query: 297 effective length of database: 378,274 effective search space: 112347378 effective search space used: 112347378 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -