BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001401-TA|BGIBMGA001401-PA|IPR003000|Silent information regulator protein Sir2 (370 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.7 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 23 4.6 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 4.6 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.4 bits (48), Expect = 2.7 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 4/78 (5%) Query: 22 EKFDSNDKLNQKC--VLLAQLVKDSKHIVVHTGAGISTSAGI--PDFRGPNGVWTLEKEG 77 EK ++DK + V++ + V + + + HT I A D R + E++ Sbjct: 849 EKSPTSDKAQEADGEVVVKKEVDEEERLENHTSVKIKREAEDRDEDERSFHSNGAKEEDE 908 Query: 78 KKPTINVSFADAQPTKTH 95 KP+++ + QP +TH Sbjct: 909 DKPSVSPLTSPRQPAETH 926 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 22.6 bits (46), Expect = 4.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 141 CNICKRQFVRSSPVETVGKKCSG 163 C +C R+F +SS V T + SG Sbjct: 52 CPVCDRRFSQSSSVTTHMRTHSG 74 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.6 bits (46), Expect = 4.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 141 CNICKRQFVRSSPVETVGKKCSG 163 C +C R+F +SS V T + SG Sbjct: 308 CPVCDRRFSQSSSVTTHMRTHSG 330 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.135 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,685 Number of Sequences: 317 Number of extensions: 3909 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 3 length of query: 370 length of database: 114,650 effective HSP length: 58 effective length of query: 312 effective length of database: 96,264 effective search space: 30034368 effective search space used: 30034368 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -