BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001230-TA|BGIBMGA001230-PA|IPR004878|Protein of unknown function DUF270 (503 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 5.0 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 23 6.6 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.0 bits (47), Expect = 5.0 Identities = 11/38 (28%), Positives = 20/38 (52%) Query: 309 WLYVLVEETKHEIHHLEHAMLSPENTTHNVTEEISCRR 346 WLY+ E + +E+ +P+NTT ++S +R Sbjct: 425 WLYLNNEGSLVYNVQIENLKTTPDNTTFITLVDVSTKR 462 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 22.6 bits (46), Expect = 6.6 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Query: 273 AQMPF-IFLTNKDIELGSHKMIQRFGFMHMLATNLC 307 AQ P I++ + GSH M Q F + TN C Sbjct: 95 AQSPHRIYMHPESPSKGSHWMNQDISFSRVKLTNTC 130 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.134 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,175 Number of Sequences: 317 Number of extensions: 3590 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 503 length of database: 114,650 effective HSP length: 60 effective length of query: 443 effective length of database: 95,630 effective search space: 42364090 effective search space used: 42364090 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -