GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001109-TA|BGIBMGA001109-PA|undefined
         (66 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY028785-1|AAK32959.1|  509|Anopheles gambiae cytochrome P450 pr...    20   7.7  
AJ010195-1|CAA09034.1|  687|Anopheles gambiae prophenoloxidase p...    20   7.7  
AF004916-1|AAB94672.1|  686|Anopheles gambiae pro-phenol oxidase...    20   7.7  

>AY028785-1|AAK32959.1|  509|Anopheles gambiae cytochrome P450
           protein.
          Length = 509

 Score = 20.2 bits (40), Expect = 7.7
 Identities = 9/31 (29%), Positives = 15/31 (48%)

Query: 7   EHHMLKVIHLRYLITVPETNFRLIQNKTDDD 37
           EH ML ++ + + +       +L    TDDD
Sbjct: 214 EHRMLAMVKMTFAMLFRAQAVKLGVKVTDDD 244


>AJ010195-1|CAA09034.1|  687|Anopheles gambiae prophenoloxidase
           protein.
          Length = 687

 Score = 20.2 bits (40), Expect = 7.7
 Identities = 6/9 (66%), Positives = 7/9 (77%)

Query: 3   NCGLEHHML 11
           NCG  HH+L
Sbjct: 582 NCGWPHHLL 590


>AF004916-1|AAB94672.1|  686|Anopheles gambiae pro-phenol oxidase
           subunit 2 protein.
          Length = 686

 Score = 20.2 bits (40), Expect = 7.7
 Identities = 6/9 (66%), Positives = 7/9 (77%)

Query: 3   NCGLEHHML 11
           NCG  HH+L
Sbjct: 581 NCGWPHHLL 589


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.322    0.138    0.426 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 80,924
Number of Sequences: 2123
Number of extensions: 3005
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of query: 66
length of database: 516,269
effective HSP length: 44
effective length of query: 22
effective length of database: 422,857
effective search space:  9302854
effective search space used:  9302854
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.4 bits)
S2: 40 (20.2 bits)