Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000998-TA|BGIBMGA000998-PA|undefined
         (124 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory pro...    20   8.0  

>DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory
           protein 14 protein.
          Length = 126

 Score = 19.8 bits (39), Expect = 8.0
 Identities = 10/33 (30%), Positives = 18/33 (54%)

Query: 32  NEPFNWRGMGYLGNPCPESEDVCVKLIERKGAQ 64
           N+P  W+ +    +P  E +    KL+E++G Q
Sbjct: 93  NKPNWWQELEAKFDPKGEYKQKYNKLLEKEGLQ 125


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.322    0.138    0.440 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,099
Number of Sequences: 317
Number of extensions: 1227
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 124
length of database: 114,650
effective HSP length: 50
effective length of query: 74
effective length of database: 98,800
effective search space:  7311200
effective search space used:  7311200
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (21.0 bits)
S2: 39 (19.8 bits)