BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000998-TA|BGIBMGA000998-PA|undefined (124 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory pro... 20 8.0 >DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory protein 14 protein. Length = 126 Score = 19.8 bits (39), Expect = 8.0 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 32 NEPFNWRGMGYLGNPCPESEDVCVKLIERKGAQ 64 N+P W+ + +P E + KL+E++G Q Sbjct: 93 NKPNWWQELEAKFDPKGEYKQKYNKLLEKEGLQ 125 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.138 0.440 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,099 Number of Sequences: 317 Number of extensions: 1227 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 124 length of database: 114,650 effective HSP length: 50 effective length of query: 74 effective length of database: 98,800 effective search space: 7311200 effective search space used: 7311200 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.0 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -