Silkworm BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000968-TA|BGIBMGA000968-PA|undefined
         (55 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g51890.1 68416.m05691 expressed protein protein At2g40060 - A...    26   3.5  

>At3g51890.1 68416.m05691 expressed protein protein At2g40060 -
           Arabidopsis thaliana, EMBL:AF002109
          Length = 237

 Score = 25.8 bits (54), Expect = 3.5
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 6/47 (12%)

Query: 13  IIPRRVFIWHQR----KTSTTTVDQLPKPATGPSDIT-VRHLIVYVK 54
           +IPR V +   R    KT+T TV Q PKP   P+D++ +R ++  +K
Sbjct: 159 LIPREVPVIENRGNKKKTATITVIQGPKPGK-PTDLSRMRQVLTKLK 204


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.327    0.137    0.450 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,316,754
Number of Sequences: 28952
Number of extensions: 37871
Number of successful extensions: 120
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 120
Number of HSP's gapped (non-prelim): 1
length of query: 55
length of database: 12,070,560
effective HSP length: 36
effective length of query: 19
effective length of database: 11,028,288
effective search space: 209537472
effective search space used: 209537472
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.8 bits)
S2: 51 (24.6 bits)