SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20076
         (660 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000D56AE2 Cluster: PREDICTED: similar to CG7945-PA,...   101   2e-20
UniRef50_Q95RY2 Cluster: LD01461p; n=5; Diptera|Rep: LD01461p - ...    87   3e-16
UniRef50_Q176J8 Cluster: Putative uncharacterized protein; n=3; ...    73   6e-12
UniRef50_O61980 Cluster: Uncoordinated protein 23, isoform a; n=...    69   1e-10
UniRef50_O95816 Cluster: BAG family molecular chaperone regulato...    68   2e-10
UniRef50_UPI00005879DA Cluster: PREDICTED: similar to Bcl2-assoc...    66   5e-10
UniRef50_UPI00005843E9 Cluster: PREDICTED: similar to pedal pept...    38   0.28 
UniRef50_Q9HLR8 Cluster: DNA double-strand break repair rad50 AT...    37   0.49 
UniRef50_Q19VG2 Cluster: RNA-dependent RNA polymerase; n=9; Magn...    36   0.86 
UniRef50_A4SHJ0 Cluster: Heat shock protein HslJ; n=1; Aeromonas...    35   1.5  
UniRef50_Q4Q9J7 Cluster: Putative uncharacterized protein; n=5; ...    35   2.0  
UniRef50_Q237J2 Cluster: Putative uncharacterized protein; n=1; ...    34   2.6  
UniRef50_O04657 Cluster: A_TM021B04.16 protein; n=2; Arabidopsis...    33   4.6  
UniRef50_A6T1X2 Cluster: Uncharacterized conserved protein; n=1;...    33   6.1  
UniRef50_UPI00015555A1 Cluster: PREDICTED: similar to Ankyrin re...    33   8.0  
UniRef50_A1ZNR5 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  
UniRef50_A2G619 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  

>UniRef50_UPI0000D56AE2 Cluster: PREDICTED: similar to CG7945-PA,
           isoform A; n=3; Endopterygota|Rep: PREDICTED: similar to
           CG7945-PA, isoform A - Tribolium castaneum
          Length = 202

 Score =  101 bits (242), Expect = 2e-20
 Identities = 43/85 (50%), Positives = 69/85 (81%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           +E  VE+LR++  ++EE++D LLS+LDS+++++L++D+ + D+DD+ +YA+RI+SR +TV
Sbjct: 47  LESHVEKLRREAAQLEEDRDHLLSSLDSVRNTDLIVDLPDNDRDDVCQYAERIMSRCLTV 106

Query: 437 EVTVRTDRDHQQEEALYQVNMYIDS 511
           EV + T RD  QEEAL+QVN  IDS
Sbjct: 107 EVKILTQRDKMQEEALHQVNHLIDS 131



 Score = 34.3 bits (75), Expect = 2.6
 Identities = 15/25 (60%), Positives = 19/25 (76%)
 Frame = +1

Query: 511 LVMSVHNDAVSAHSRCQTYMNACTS 585
           LVM V +D  SA +RC T+MNAC+S
Sbjct: 132 LVMCVKSDPESAKARCITFMNACSS 156


>UniRef50_Q95RY2 Cluster: LD01461p; n=5; Diptera|Rep: LD01461p -
           Drosophila melanogaster (Fruit fly)
          Length = 262

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 39/85 (45%), Positives = 64/85 (75%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           ++ RVE+LRKD + ++E+KD LL ++D IK +E++ ++SE ++++I  Y  R+ SR  TV
Sbjct: 98  LDARVEKLRKDALNLQEKKDYLLMSMDLIKSNEMMQNMSEAEREEIILYLQRVSSRLATV 157

Query: 437 EVTVRTDRDHQQEEALYQVNMYIDS 511
           E+ VRT RD+ QE++L Q+N+ IDS
Sbjct: 158 ELRVRTVRDNSQEDSLSQINVLIDS 182


>UniRef50_Q176J8 Cluster: Putative uncharacterized protein; n=3;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 226

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 34/84 (40%), Positives = 57/84 (67%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           ++ +VE+LRKD + ++E+KD L  ++D +K++E L  ++E + ++I  Y  RI  R  TV
Sbjct: 67  LDSKVEKLRKDALMLQEKKDFLAMSMDLLKNNEYLTGLNESEYEEINCYVQRISGRLATV 126

Query: 437 EVTVRTDRDHQQEEALYQVNMYID 508
           E++V T RD  QE++L+ VN  ID
Sbjct: 127 ELSVCTVRDRAQEDSLHLVNSLID 150


>UniRef50_O61980 Cluster: Uncoordinated protein 23, isoform a; n=4;
           Caenorhabditis|Rep: Uncoordinated protein 23, isoform a
           - Caenorhabditis elegans
          Length = 458

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 30/84 (35%), Positives = 50/84 (59%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           +E++VE+LRK    +E EK+ +L +L  I     +  + ECD+++I    DR+  R  TV
Sbjct: 296 IELQVEQLRKKAAELEMEKEQILRSLGEISVHNCMFKLEECDREEIEAITDRLTKRTKTV 355

Query: 437 EVTVRTDRDHQQEEALYQVNMYID 508
           +V V T R+ +Q++AL    + ID
Sbjct: 356 QVVVETPRNEEQKKALEDATLMID 379


>UniRef50_O95816 Cluster: BAG family molecular chaperone regulator
           2; n=22; Euteleostomi|Rep: BAG family molecular
           chaperone regulator 2 - Homo sapiens (Human)
          Length = 211

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 32/84 (38%), Positives = 57/84 (67%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           +E+RVE LR+    +E+EK+ LL  + SI++S+ +  IS+ +++++   A+R++ R +TV
Sbjct: 35  LELRVEALREAATAVEQEKEILLEMIHSIQNSQDMRQISDGEREELNLTANRLMGRTLTV 94

Query: 437 EVTVRTDRDHQQEEALYQVNMYID 508
           EV+V T R+ QQ+E+L      ID
Sbjct: 95  EVSVETIRNPQQQESLKHATRIID 118


>UniRef50_UPI00005879DA Cluster: PREDICTED: similar to
           Bcl2-associated athanogene 2; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to Bcl2-associated
           athanogene 2 - Strongylocentrotus purpuratus
          Length = 214

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 29/83 (34%), Positives = 58/83 (69%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           +E+RVE++R+    IE+EK  LL++L+++  SE +  +S  +++++  Y DR+++R +TV
Sbjct: 50  LELRVEKMRETARSIEDEKTRLLNSLNTMMQSEAIDHLSGAEREELGLYIDRLVTRCLTV 109

Query: 437 EVTVRTDRDHQQEEALYQVNMYI 505
           ++ ++T R   QEE+L +V  Y+
Sbjct: 110 DINIQTIRTPAQEESLRKVKGYL 132


>UniRef50_UPI00005843E9 Cluster: PREDICTED: similar to pedal peptide
           precursor protein; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to pedal peptide
           precursor protein - Strongylocentrotus purpuratus
          Length = 510

 Score = 37.5 bits (83), Expect = 0.28
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = +2

Query: 260 EMRVERLRKDTVR-IEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTV 436
           E R  R  +D    +E+E+DSL++ L+ +   E ++D +E D DD T   DR LS  +++
Sbjct: 28  ECRPARKTRDVDEDLEKEEDSLINALEKVLADEEVIDNAENDSDDETGITDRELSLMLSM 87


>UniRef50_Q9HLR8 Cluster: DNA double-strand break repair rad50
           ATPase; n=1; Thermoplasma acidophilum|Rep: DNA
           double-strand break repair rad50 ATPase - Thermoplasma
           acidophilum
          Length = 896

 Score = 36.7 bits (81), Expect = 0.49
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 6/73 (8%)
 Frame = +2

Query: 296 RIEEEKDSLLSTLDS----IKHSELLLDISECDKDDITRYADRI--LSRAMTVEVTVRTD 457
           ++EE  D L   +DS    I + + L+  +E D+DD+ RY D +  LS+ +  E  + +D
Sbjct: 163 KLEETYDVLKDVIDSLQAGISNLDYLISENERDRDDLRRYQDDVAELSKQIDQEEAIESD 222

Query: 458 RDHQQEEALYQVN 496
              ++EEA  + N
Sbjct: 223 LLRKKEEASAEYN 235


>UniRef50_Q19VG2 Cluster: RNA-dependent RNA polymerase; n=9;
            Magnoliophyta|Rep: RNA-dependent RNA polymerase - Zea
            mays (Maize)
          Length = 1127

 Score = 35.9 bits (79), Expect = 0.86
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +2

Query: 224  AERQTDSSTR*VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRY 403
            AER+ +  T  +  ++  LR+D  R  E KD +++ +D++ H+E+   +  C +DD +R 
Sbjct: 1014 AEREDEILTGNIRNKLVYLRRDNKRYFEMKDRIIAAVDAL-HAEVRGWLRACKEDDASRV 1072

Query: 404  A 406
            A
Sbjct: 1073 A 1073


>UniRef50_A4SHJ0 Cluster: Heat shock protein HslJ; n=1; Aeromonas
           salmonicida subsp. salmonicida A449|Rep: Heat shock
           protein HslJ - Aeromonas salmonicida (strain A449)
          Length = 139

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = -1

Query: 252 LVLLSVCLSAPAFLEPRIRR*GVVVNPLDTQSL-MQIDPPP*FEMHFH*TVS 100
           L+LLS C S P+F++  ++    V++ LD Q++    D PP FE+  H TV+
Sbjct: 11  LLLLSACSSTPSFVQQDLQHHHWVLDKLDGQAIAASRDNPPDFEIGEHFTVN 62


>UniRef50_Q4Q9J7 Cluster: Putative uncharacterized protein; n=5;
           Trypanosomatidae|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 961

 Score = 34.7 bits (76), Expect = 2.0
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 3/78 (3%)
 Frame = +2

Query: 269 VERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEV-- 442
           V RLR++T ++EEE   L +   +I + +  LD+++ DK   T+  + IL     VE   
Sbjct: 494 VSRLREETNQLEEE---LGARQAAIANKQKQLDLAKLDK---TKCREAILRERGNVEAMR 547

Query: 443 -TVRTDRDHQQEEALYQV 493
            T+ T+R HQ+E+ + Q+
Sbjct: 548 KTLLTERRHQREQWIKQI 565


>UniRef50_Q237J2 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 636

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 24/82 (29%), Positives = 43/82 (52%)
 Frame = +2

Query: 251 R*VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAM 430
           R VEM + +  +    +EE+ D +LS  D  ++ +L L I + +KD     AD +  + M
Sbjct: 510 RNVEMEITKRIQQKKNLEEDLDHILSDADLEEYKKLGLQIRQLEKD-----ADDLNKKRM 564

Query: 431 TVEVTVRTDRDHQQEEALYQVN 496
            V+    TD D  Q++ + ++N
Sbjct: 565 RVQ----TDVDQIQQQVVVRIN 582


>UniRef50_O04657 Cluster: A_TM021B04.16 protein; n=2; Arabidopsis
           thaliana|Rep: A_TM021B04.16 protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 299

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 2/52 (3%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRI--EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYA 406
           +E R++R++K  +    +EEK  L+S+ D   +S   LD+ +CD    ++ A
Sbjct: 116 IEDRLQRMKKHVMACLEKEEKSQLVSSFDQNPNSTCSLDVEDCDGSSYSQIA 167


>UniRef50_A6T1X2 Cluster: Uncharacterized conserved protein; n=1;
           Janthinobacterium sp. Marseille|Rep: Uncharacterized
           conserved protein - Janthinobacterium sp. (strain
           Marseille) (Minibacterium massiliensis)
          Length = 559

 Score = 33.1 bits (72), Expect = 6.1
 Identities = 18/65 (27%), Positives = 33/65 (50%)
 Frame = +3

Query: 129 TMEVDQFALEIAYPEGSRLPLIDESSVLGTQAPKDRLIAVLDKSRCEWRGSEKTQSGLKK 308
           T  +  + L++A     + P++D+     T+A  D+L+A+L      WR +   QSG   
Sbjct: 382 TEGISNYHLQVASDAAFKTPVLDQK----TEAGADQLVALLPVGHYYWRVASIIQSGGTS 437

Query: 309 KRTPY 323
           K+ P+
Sbjct: 438 KQGPF 442


>UniRef50_UPI00015555A1 Cluster: PREDICTED: similar to Ankyrin
           repeat domain 24; n=1; Ornithorhynchus anatinus|Rep:
           PREDICTED: similar to Ankyrin repeat domain 24 -
           Ornithorhynchus anatinus
          Length = 489

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 17/43 (39%), Positives = 27/43 (62%)
 Frame = +2

Query: 239 DSSTR*VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLD 367
           DSS   +E ++E L+K  V  +EEK+SL   L+S++    LL+
Sbjct: 333 DSSLHALEKQIEELQKQLVDKQEEKESLSKELESLQSRLSLLE 375


>UniRef50_A1ZNR5 Cluster: Putative uncharacterized protein; n=1;
           Microscilla marina ATCC 23134|Rep: Putative
           uncharacterized protein - Microscilla marina ATCC 23134
          Length = 584

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = +3

Query: 150 ALEIAYPEGSRLPLIDESSVLGTQAPKDRLIAVLDKSRCEWRGSEKT 290
           AL++  P+GS LPL  +S+  G+ AP  R+I   D    + +  +KT
Sbjct: 188 ALQMKLPQGSTLPLPQKSTPSGSNAPVQRVIKTKDGESYDKQYLKKT 234


>UniRef50_A2G619 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 970

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 19/78 (24%), Positives = 42/78 (53%), Gaps = 4/78 (5%)
 Frame = +2

Query: 194 RRILGSRNAGAERQTDSSTR*VEMRVERLRKDTVRIEEEKDSLLSTL----DSIKHSELL 361
           ++IL +++     Q +S T  + +  E+L ++   ++ EK+SLL+ +     S   ++L 
Sbjct: 343 QKILNNKSKDKREQRESYTNLISIENEKLHREIESLKTEKESLLAEVRAAHTSYNQAKLA 402

Query: 362 LDISECDKDDITRYADRI 415
            + SE +K+ I +   +I
Sbjct: 403 SETSEANKNSILKANKKI 420


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 662,952,701
Number of Sequences: 1657284
Number of extensions: 13793448
Number of successful extensions: 39234
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 36641
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39203
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 50000004659
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -