SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20064
         (713 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q1HQA2 Cluster: ADP-ribosylation factor-like 6 interact...   184   3e-45
UniRef50_UPI0000D57021 Cluster: PREDICTED: similar to ADP-ribosy...    87   3e-16
UniRef50_UPI0000DB6D47 Cluster: PREDICTED: similar to ARL-6-inte...    77   6e-13
UniRef50_Q9VES1 Cluster: ARL-6-interacting protein 1 homolog; n=...    66   1e-09
UniRef50_UPI0000E486E8 Cluster: PREDICTED: similar to ADP-ribosy...    55   2e-06
UniRef50_Q5ZUH9 Cluster: Lipid A export ATP-binding/permease pro...    37   0.43 
UniRef50_Q9K6N5 Cluster: BH3693 protein; n=1; Bacillus haloduran...    35   1.7  
UniRef50_A6Q2Q6 Cluster: Putative uncharacterized protein; n=1; ...    35   1.7  
UniRef50_P54683 Cluster: Prestalk-specific protein tagB precurso...    35   1.7  
UniRef50_Q8A9X2 Cluster: Putative uncharacterized protein; n=3; ...    34   4.0  
UniRef50_A6UKW9 Cluster: Putative uncharacterized protein; n=1; ...    33   5.3  
UniRef50_Q89VE5 Cluster: Blr1102 protein; n=11; Bradyrhizobiacea...    33   9.2  

>UniRef50_Q1HQA2 Cluster: ADP-ribosylation factor-like 6 interacting
           protein isoform 1; n=3; Bombyx mori|Rep:
           ADP-ribosylation factor-like 6 interacting protein
           isoform 1 - Bombyx mori (Silk moth)
          Length = 198

 Score =  184 bits (447), Expect = 3e-45
 Identities = 87/100 (87%), Positives = 88/100 (88%)
 Frame = +3

Query: 207 KSKANFRRLACSLTLSKSVILWEQQWHPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLIL 386
           K K        +L   KSVILWEQQWHPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLIL
Sbjct: 17  KVKRTLEGWRVALLSLKSVILWEQQWHPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLIL 76

Query: 387 NFVDFMVPVICNQLYGSSSWTGQHEKTFEEICRSIVISYN 506
           NFVDFMVPVICNQLYGSSSWTGQHEKTFEEICRSIVISYN
Sbjct: 77  NFVDFMVPVICNQLYGSSSWTGQHEKTFEEICRSIVISYN 116



 Score =  109 bits (263), Expect = 5e-23
 Identities = 60/87 (68%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +2

Query: 455 TREDI*RNL*KHCNKLQ*LVIYIHSFYSLRDTSPFMYYTISISTLCTVAWISSSINNIFX 634
           T E+I R++    NKL   VIYIHSFYSLRDTSPFMYYTISISTLCTVAWISSSINNIF 
Sbjct: 103 TFEEICRSIVISYNKL---VIYIHSFYSLRDTSPFMYYTISISTLCTVAWISSSINNIFL 159

Query: 635 XXXXXXXXXXWPGIQRMG-FQ*FFSVV 712
                     WPGIQR G F  FFSVV
Sbjct: 160 LYLLSTVVLLWPGIQRSGIFNSFFSVV 186



 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 32/32 (100%), Positives = 32/32 (100%)
 Frame = +1

Query: 160 MGEKSSTVQDQEQQVRKVKRTLEGWRVALLSL 255
           MGEKSSTVQDQEQQVRKVKRTLEGWRVALLSL
Sbjct: 1   MGEKSSTVQDQEQQVRKVKRTLEGWRVALLSL 32


>UniRef50_UPI0000D57021 Cluster: PREDICTED: similar to
           ADP-ribosylation factor-like 6 interacting protein; n=1;
           Tribolium castaneum|Rep: PREDICTED: similar to
           ADP-ribosylation factor-like 6 interacting protein -
           Tribolium castaneum
          Length = 200

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 31/82 (37%), Positives = 55/82 (67%)
 Frame = +3

Query: 252 SKSVILWEQQWHPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLILNFVDFMVPVICNQLY 431
           +K V++WE+QWHP AIVG  TI++  +WLLD + L   ++ GL+L   D+++P I + ++
Sbjct: 25  AKRVLVWEKQWHPTAIVGGSTILFTFLWLLDPSILTVFSVFGLVLTIFDYLIPSIGSSMF 84

Query: 432 GSSSWTGQHEKTFEEICRSIVI 497
               WT + E+ +EE C ++++
Sbjct: 85  KPEMWTARKEQEYEEFCTNVIL 106



 Score = 41.1 bits (92), Expect = 0.026
 Identities = 16/53 (30%), Positives = 29/53 (54%)
 Frame = +2

Query: 530 FYSLRDTSPFMYYTISISTLCTVAWISSSINNIFXXXXXXXXXXXWPGIQRMG 688
           FY ++ T+  MY+ +++ TL  +AWI  + NN+F           +PG++  G
Sbjct: 118 FYKMKSTNRKMYFLLTMITLSALAWIGCTFNNLFLSYVFVTFLLLFPGMEHNG 170


>UniRef50_UPI0000DB6D47 Cluster: PREDICTED: similar to
           ARL-6-interacting protein 1 (ADP-ribosylation-like
           factor 6-interacting protein 1) (Aip-1) (Protein TBX2);
           n=1; Apis mellifera|Rep: PREDICTED: similar to
           ARL-6-interacting protein 1 (ADP-ribosylation-like
           factor 6-interacting protein 1) (Aip-1) (Protein TBX2) -
           Apis mellifera
          Length = 194

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 33/80 (41%), Positives = 52/80 (65%)
 Frame = +3

Query: 258 SVILWEQQWHPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLILNFVDFMVPVICNQLYGS 437
           S++LWE+ W+P  I+G  T ++ LIW+L+   L  I++  LIL  VD++VP + + L   
Sbjct: 32  SILLWERSWYPGLILGITTTIFFLIWMLEPAILTIISVSLLILALVDYLVPPVSSLLSPV 91

Query: 438 SSWTGQHEKTFEEICRSIVI 497
           + WTGQ EK   EIC+++ I
Sbjct: 92  NKWTGQKEKKLNEICQNLSI 111



 Score = 33.5 bits (73), Expect = 5.3
 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 4/70 (5%)
 Frame = +2

Query: 491 CNKLQ*LVIYIHSFYSL----RDTSPFMYYTISISTLCTVAWISSSINNIFXXXXXXXXX 658
           C  L  +++ + S + L    R+  P +YY   I+ L    WI S+INN+          
Sbjct: 106 CQNLSIIILQLQSLWKLMLKTRNDRPNVYYAGIITCLIICIWIGSTINNLLLFYITVNIL 165

Query: 659 XXWPGIQRMG 688
              PG +  G
Sbjct: 166 LLTPGFRYKG 175


>UniRef50_Q9VES1 Cluster: ARL-6-interacting protein 1 homolog; n=2;
           Sophophora|Rep: ARL-6-interacting protein 1 homolog -
           Drosophila melanogaster (Fruit fly)
          Length = 197

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 23/95 (24%), Positives = 55/95 (57%)
 Frame = +3

Query: 207 KSKANFRRLACSLTLSKSVILWEQQWHPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLIL 386
           K K +      ++  +  V+ WE+Q++   + G ++ +YL++W LDL+ +  ++++G+I 
Sbjct: 14  KLKHDLEPFRTAIVGAYGVLTWEKQYYAGVVFGVISCLYLVLWYLDLSLITLLSLLGVIS 73

Query: 387 NFVDFMVPVICNQLYGSSSWTGQHEKTFEEICRSI 491
             +++  P++   ++G  +W G  E  FE++C  +
Sbjct: 74  ILLNYAFPMVSRLIFGGVNWDGDQEAKFEDVCGQV 108


>UniRef50_UPI0000E486E8 Cluster: PREDICTED: similar to
           ADP-ribosylation factor-like 6 interacting protein; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           ADP-ribosylation factor-like 6 interacting protein -
           Strongylocentrotus purpuratus
          Length = 199

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 17/75 (22%), Positives = 46/75 (61%)
 Frame = +3

Query: 270 WEQQWHPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLILNFVDFMVPVICNQLYGSSSWT 449
           W++  +P  +  ++T+ Y+LIWL+  + L +++++ + +  +DFMVP +  + +   +W+
Sbjct: 36  WDEDSYPYIMCAAITVFYILIWLIQPSILTTVSLIIMTVCLLDFMVPSVFKEYFKKQAWS 95

Query: 450 GQHEKTFEEICRSIV 494
              ++ +E+ C  ++
Sbjct: 96  EFKQRRYEKCCSKLL 110


>UniRef50_Q5ZUH9 Cluster: Lipid A export ATP-binding/permease
           protein msbA; n=5; Legionella pneumophila|Rep: Lipid A
           export ATP-binding/permease protein msbA - Legionella
           pneumophila subsp. pneumophila (strain Philadelphia 1
           /ATCC 33152 / DSM 7513)
          Length = 588

 Score = 37.1 bits (82), Expect = 0.43
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +3

Query: 291 CAIVGSMTIMYLLIWLLDLNTLASIAIVGLILNFVDFMVPVICNQL 428
           C ++G +T+M ++ W L L  L +I  VG+I+N+ +  V  I +++
Sbjct: 151 CLVIGLLTVMMVICWQLSLMFLLTIPFVGIIVNYTNKRVRRISHKV 196


>UniRef50_Q9K6N5 Cluster: BH3693 protein; n=1; Bacillus
           halodurans|Rep: BH3693 protein - Bacillus halodurans
          Length = 405

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = +3

Query: 342 DLNTLASIAIVGLIL-NFVDFMVPVICNQLYGSSSWTG 452
           +L+ +   A+VG++L N + F  P I  Q+ GSSSWTG
Sbjct: 16  ELDIIRGFALVGILLANMMYFATPGIYVQMAGSSSWTG 53


>UniRef50_A6Q2Q6 Cluster: Putative uncharacterized protein; n=1;
           Nitratiruptor sp. SB155-2|Rep: Putative uncharacterized
           protein - Nitratiruptor sp. (strain SB155-2)
          Length = 387

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 19/61 (31%), Positives = 34/61 (55%)
 Frame = +1

Query: 523 PFILFPTRYQPIYVLHYLHQYIVYCSLDILFY*QHFPVVFIVNSSTALAWHTAHGISIVF 702
           PFI+F T    IY+ H   +++ Y S  +LF+ Q F ++F+  S +   W+    I++ +
Sbjct: 106 PFIIFCTLIV-IYIYHNHDRWLPYFSTVLLFFDQSFAILFL--SISMFYWYKKEKIALYY 162

Query: 703 F 705
           F
Sbjct: 163 F 163


>UniRef50_P54683 Cluster: Prestalk-specific protein tagB precursor;
            n=4; Dictyostelium discoideum|Rep: Prestalk-specific
            protein tagB precursor - Dictyostelium discoideum (Slime
            mold)
          Length = 1905

 Score = 35.1 bits (77), Expect = 1.7
 Identities = 16/56 (28%), Positives = 27/56 (48%)
 Frame = +3

Query: 291  CAIVGSMTIMYLLIWLLDLNTLASIAIVGLILNFVDFMVPVICNQLYGSSSWTGQH 458
            C +VGS+  ++ + W L L   A++ I+GL+          +  QL   +S   QH
Sbjct: 1204 CKLVGSLVFIFTISWKLSLAFFAAVPILGLVTQIQSQFTKRLTRQLLFHNSKASQH 1259


>UniRef50_Q8A9X2 Cluster: Putative uncharacterized protein; n=3;
           Bacteroides|Rep: Putative uncharacterized protein -
           Bacteroides thetaiotaomicron
          Length = 793

 Score = 33.9 bits (74), Expect = 4.0
 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
 Frame = +3

Query: 285 HPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLI-LNFVDF 401
           H C   G+MTI+ + +W   +  L ++ ++GLI LNF DF
Sbjct: 335 HKCNGAGNMTILSMFLWETAIIILFALILMGLILLNFQDF 374


>UniRef50_A6UKW9 Cluster: Putative uncharacterized protein; n=1;
           Sinorhizobium medicae WSM419|Rep: Putative
           uncharacterized protein - Sinorhizobium medicae WSM419
          Length = 441

 Score = 33.5 bits (73), Expect = 5.3
 Identities = 16/40 (40%), Positives = 23/40 (57%)
 Frame = +3

Query: 3   ARGLVKSSLFGYLQTSNNFLVIYEKRNRIALLIKFLIRVT 122
           A GLV+ + FGYL+ S N+LV+  +  R   L  F   +T
Sbjct: 143 AAGLVQGAAFGYLRDSANYLVVQSQMTRALALAAFASDLT 182


>UniRef50_Q89VE5 Cluster: Blr1102 protein; n=11;
           Bradyrhizobiaceae|Rep: Blr1102 protein - Bradyrhizobium
           japonicum
          Length = 415

 Score = 32.7 bits (71), Expect = 9.2
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +3

Query: 243 LTLSKSVILWEQQWHPCAIVGSMTIMYLLIWLLDL 347
           L L+  +ILW  +W P   +G   ++Y + W  DL
Sbjct: 180 LMLALPLILWSMKWKPDVTLGLSVVLYAVTWEYDL 214


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 690,993,283
Number of Sequences: 1657284
Number of extensions: 13269197
Number of successful extensions: 33638
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 32478
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33632
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 57438021881
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -