SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20031
         (764 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P62888 Cluster: 60S ribosomal protein L30; n=127; Eukar...    67   5e-10
UniRef50_Q8VZ19 Cluster: 60S ribosomal protein L30-2; n=34; Euka...    55   2e-06
UniRef50_P58374 Cluster: 60S ribosomal protein L30; n=20; Eukary...    54   3e-06
UniRef50_P14120 Cluster: 60S ribosomal protein L30; n=6; Eukaryo...    45   0.002
UniRef50_P49153 Cluster: 60S ribosomal protein L30; n=15; Eukary...    44   0.004
UniRef50_Q7XYC7 Cluster: Ribosomal protein L30; n=1; Triticum ae...    40   0.089
UniRef50_Q00T87 Cluster: Chromosome 17 contig 1, DNA sequence; n...    40   0.089
UniRef50_A0BYD7 Cluster: Chromosome undetermined scaffold_137, w...    39   0.16 
UniRef50_Q9XG43 Cluster: 60S ribosomal protein L30; n=1; Guillar...    38   0.36 
UniRef50_A2DH05 Cluster: 60S ribosomal protein L30, putative; n=...    38   0.36 
UniRef50_Q6R7L3 Cluster: ORF10; n=1; Ostreid herpesvirus 1|Rep: ...    33   7.8  

>UniRef50_P62888 Cluster: 60S ribosomal protein L30; n=127;
           Eukaryota|Rep: 60S ribosomal protein L30 - Homo sapiens
           (Human)
          Length = 115

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 32/42 (76%), Positives = 36/42 (85%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           MVAAKK KK++ESINSRL LVMKSGKY LGYKQTLK+  + K
Sbjct: 1   MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGK 42



 Score = 37.5 bits (83), Expect = 0.36
 Identities = 17/32 (53%), Positives = 22/32 (68%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK +L  +   + +RQGKAKLVI+A N P LR
Sbjct: 25  GKYVLGYKQTLKMIRQGKAKLVILANNCPALR 56


>UniRef50_Q8VZ19 Cluster: 60S ribosomal protein L30-2; n=34;
           Eukaryota|Rep: 60S ribosomal protein L30-2 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 112

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 27/36 (75%), Positives = 28/36 (77%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLK 257
           MV  KK KK+ E INSRLALVMKSGKY LGYK  LK
Sbjct: 1   MVTEKKTKKSHEGINSRLALVMKSGKYTLGYKSVLK 36



 Score = 34.3 bits (75), Expect = 3.4
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +2

Query: 161 KETEKDHRVN*LPPCLGDEIGKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           K+T+K H        L  + GK  L  ++  ++LR  K KL++I+ N PPLR
Sbjct: 5   KKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRGSKGKLILISTNCPPLR 56


>UniRef50_P58374 Cluster: 60S ribosomal protein L30; n=20;
           Eukaryota|Rep: 60S ribosomal protein L30 - Branchiostoma
           belcheri (Amphioxus)
          Length = 114

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 25/38 (65%), Positives = 32/38 (84%)
 Frame = +3

Query: 162 KKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           K+++KT+ESINSRL LVMKSGKY LG K+TLK+  + K
Sbjct: 2   KQKRKTMESINSRLQLVMKSGKYVLGLKETLKVLRQGK 39



 Score = 40.3 bits (90), Expect = 0.051
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK +L ++   + LRQGKAKL+IIA N P LR
Sbjct: 22  GKYVLGLKETLKVLRQGKAKLIIIANNTPALR 53


>UniRef50_P14120 Cluster: 60S ribosomal protein L30; n=6;
           Eukaryota|Rep: 60S ribosomal protein L30 - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 105

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/34 (61%), Positives = 26/34 (76%)
 Frame = +3

Query: 174 KTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           K+ ESIN +LALV+KSGKY LGYK T+K   + K
Sbjct: 5   KSQESINQKLALVIKSGKYTLGYKSTVKSLRQGK 38



 Score = 37.1 bits (82), Expect = 0.48
 Identities = 17/32 (53%), Positives = 23/32 (71%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK  L  ++  ++LRQGK+KL+IIA N P LR
Sbjct: 21  GKYTLGYKSTVKSLRQGKSKLIIIAANTPVLR 52


>UniRef50_P49153 Cluster: 60S ribosomal protein L30; n=15;
           Eukaryota|Rep: 60S ribosomal protein L30 - Trypanosoma
           brucei brucei
          Length = 105

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 19/33 (57%), Positives = 27/33 (81%)
 Frame = +3

Query: 159 AKKQKKTIESINSRLALVMKSGKYCLGYKQTLK 257
           AKK K  +++IN+++ LVMKSGKY LG +Q+LK
Sbjct: 2   AKKVKSKVDTINTKIQLVMKSGKYVLGTQQSLK 34



 Score = 41.5 bits (93), Expect = 0.022
 Identities = 17/32 (53%), Positives = 25/32 (78%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK +L  Q + +TLRQG++KLV+I+ N PP+R
Sbjct: 23  GKYVLGTQQSLKTLRQGRSKLVVISANCPPIR 54


>UniRef50_Q7XYC7 Cluster: Ribosomal protein L30; n=1; Triticum
           aestivum|Rep: Ribosomal protein L30 - Triticum aestivum
           (Wheat)
          Length = 75

 Score = 39.5 bits (88), Expect = 0.089
 Identities = 17/30 (56%), Positives = 23/30 (76%)
 Frame = +3

Query: 168 QKKTIESINSRLALVMKSGKYCLGYKQTLK 257
           +++   +IN++L LVMKSGKY LGYK  LK
Sbjct: 24  RRRARRNINNKLQLVMKSGKYTLGYKTVLK 53


>UniRef50_Q00T87 Cluster: Chromosome 17 contig 1, DNA sequence; n=1;
           Ostreococcus tauri|Rep: Chromosome 17 contig 1, DNA
           sequence - Ostreococcus tauri
          Length = 170

 Score = 39.5 bits (88), Expect = 0.089
 Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
 Frame = -2

Query: 307 RSIFSDDNQLCFALSKSFKVCLYPKQYFPDFITKARRELIDSMVFF--CFFAATIL 146
           R +F+ +  L   L K F V LYP  Y PD +T   REL+ S  FF  CF A   L
Sbjct: 110 RVLFAINTNLLAPLRKVFSVDLYPSVYRPDRMTIVSRELMPSAAFFEPCFGAIFFL 165


>UniRef50_A0BYD7 Cluster: Chromosome undetermined scaffold_137,
           whole genome shotgun sequence; n=5; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_137,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 201

 Score = 38.7 bits (86), Expect = 0.16
 Identities = 16/25 (64%), Positives = 21/25 (84%)
 Frame = +3

Query: 183 ESINSRLALVMKSGKYCLGYKQTLK 257
           ES+N +L LV++SGK  +GYKQTLK
Sbjct: 8   ESVNQKLQLVVRSGKITMGYKQTLK 32


>UniRef50_Q9XG43 Cluster: 60S ribosomal protein L30; n=1; Guillardia
           theta|Rep: 60S ribosomal protein L30 - Guillardia theta
           (Cryptomonas phi)
          Length = 107

 Score = 37.5 bits (83), Expect = 0.36
 Identities = 15/31 (48%), Positives = 23/31 (74%)
 Frame = +3

Query: 165 KQKKTIESINSRLALVMKSGKYCLGYKQTLK 257
           K K T E ++S+L +++K+GK+  GYK TLK
Sbjct: 5   KNKSTSELLSSKLKIIIKTGKFSYGYKATLK 35


>UniRef50_A2DH05 Cluster: 60S ribosomal protein L30, putative; n=5;
           Eukaryota|Rep: 60S ribosomal protein L30, putative -
           Trichomonas vaginalis G3
          Length = 112

 Score = 37.5 bits (83), Expect = 0.36
 Identities = 19/32 (59%), Positives = 22/32 (68%)
 Frame = +3

Query: 162 KKQKKTIESINSRLALVMKSGKYCLGYKQTLK 257
           KK  +  ESI + L+LV KSGKY LG  QTLK
Sbjct: 4   KKLSRARESIINSLSLVTKSGKYSLGISQTLK 35


>UniRef50_Q6R7L3 Cluster: ORF10; n=1; Ostreid herpesvirus 1|Rep:
           ORF10 - Ostreid herpesvirus 1
          Length = 342

 Score = 33.1 bits (72), Expect = 7.8
 Identities = 20/82 (24%), Positives = 37/82 (45%)
 Frame = +3

Query: 21  LDFSKFHSVSIALTALNKSFYNTYRGY*IHCFILGFISIYASKMVAAKKQKKTIESINSR 200
           LDF  F    I  + +    +N ++GY  HC++   + I A +      + +++E     
Sbjct: 70  LDFLLFWKGKIEYSTVINELFNAHKGYFHHCYM---VDIIAKRYARKLYKPESLEENKEW 126

Query: 201 LALVMKSGKYCLGYKQTLKLFD 266
           LAL  K+G     + +   L+D
Sbjct: 127 LALATKAGFMADSFFRKNNLYD 148


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 707,668,183
Number of Sequences: 1657284
Number of extensions: 13584631
Number of successful extensions: 27341
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 26563
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27339
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 63792713725
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -