SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20026
         (735 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00005A4635 Cluster: PREDICTED: similar to statin-lik...   223   4e-57
UniRef50_Q05639 Cluster: Elongation factor 1-alpha 2; n=8397; ro...   223   4e-57
UniRef50_P13905 Cluster: Elongation factor 1-alpha; n=2224; cell...   202   9e-51
UniRef50_Q5EMT9 Cluster: Elongation factor 1-alpha-like protein;...   200   2e-50
UniRef50_UPI0000EB0538 Cluster: UPI0000EB0538 related cluster; n...   177   2e-43
UniRef50_Q8IFW1 Cluster: Elongation factor-1 alpha; n=1; Exoneur...   174   2e-42
UniRef50_P50257 Cluster: Elongation factor 1-alpha S; n=1; Porph...   172   7e-42
UniRef50_Q96TP0 Cluster: Elongation factor 1 alpha; n=5; Fungi/M...   164   2e-39
UniRef50_P35021 Cluster: Elongation factor 1-alpha; n=53; cellul...   138   1e-31
UniRef50_Q9Y450 Cluster: HBS1-like protein; n=43; Euteleostomi|R...   130   3e-29
UniRef50_UPI0000499ED8 Cluster: guanine nucleotide regulatory pr...   130   3e-29
UniRef50_P15170 Cluster: G1 to S phase transition protein 1 homo...   130   3e-29
UniRef50_Q96WS7 Cluster: Eukaryotic release factor 3; n=1; Pneum...   127   2e-28
UniRef50_P90922 Cluster: Putative uncharacterized protein; n=3; ...   127   3e-28
UniRef50_O45622 Cluster: Putative uncharacterized protein; n=2; ...   127   3e-28
UniRef50_A6RVA8 Cluster: Putative uncharacterized protein; n=1; ...   127   3e-28
UniRef50_UPI0000D55B6A Cluster: PREDICTED: similar to CG1898-PA;...   124   2e-27
UniRef50_O93729 Cluster: Elongation factor 1-alpha; n=20; Archae...   124   3e-27
UniRef50_A4ZCD1 Cluster: GTP-binding protein; n=9; Magnoliophyta...   123   5e-27
UniRef50_Q86NR4 Cluster: RE29053p; n=5; Diptera|Rep: RE29053p - ...   121   2e-26
UniRef50_A2AX44 Cluster: Translation elongation factor 1 like; n...   121   2e-26
UniRef50_Q8IIC9 Cluster: Translation elongation factor EF-1, sub...   121   2e-26
UniRef50_Q5UHI3 Cluster: EF-1 alpha-like protein; n=6; Eukaryota...   120   4e-26
UniRef50_Q00WU5 Cluster: EF-1 alpha-like protein; n=1; Ostreococ...   120   4e-26
UniRef50_A7D4X8 Cluster: Translation elongation factor EF-1, sub...   120   5e-26
UniRef50_Q9HGI4 Cluster: Eukaryotic peptide chain release factor...   120   5e-26
UniRef50_O74718 Cluster: Eukaryotic peptide chain release factor...   119   6e-26
UniRef50_Q17263 Cluster: Elongation factor 1 alpha; n=4; Fungi/M...   119   9e-26
UniRef50_UPI0000DD78A4 Cluster: PREDICTED: similar to statin-lik...   118   1e-25
UniRef50_A6RA16 Cluster: Putative uncharacterized protein; n=1; ...   118   1e-25
UniRef50_O13354 Cluster: Eukaryotic peptide chain release factor...   118   1e-25
UniRef50_Q5KFJ4 Cluster: Translation release factor, putative; n...   118   2e-25
UniRef50_A2QW82 Cluster: Contig An11c0160, complete genome; n=8;...   118   2e-25
UniRef50_P05453 Cluster: Eukaryotic peptide chain release factor...   118   2e-25
UniRef50_Q9NCN7 Cluster: Eukaryotic release factor 3 GTPase subu...   116   6e-25
UniRef50_A3LY56 Cluster: Predicted protein; n=2; Pichia|Rep: Pre...   115   1e-24
UniRef50_Q0U4R2 Cluster: Putative uncharacterized protein; n=1; ...   114   2e-24
UniRef50_Q2U0M0 Cluster: Translation elongation factor EF-1 alph...   114   2e-24
UniRef50_A7RM15 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...   112   7e-24
UniRef50_Q759Q2 Cluster: ADR221Cp; n=3; Saccharomycetales|Rep: A...   112   1e-23
UniRef50_UPI0000E47BF2 Cluster: PREDICTED: similar to elongation...   111   1e-23
UniRef50_Q6BVD7 Cluster: Similar to sp|P32769 Saccharomyces cere...   111   1e-23
UniRef50_Q4QGW5 Cluster: Eukaryotic release factor 3, putative; ...   111   2e-23
UniRef50_Q9NCN8 Cluster: Eukaryotic release factor 3 GTPase subu...   111   2e-23
UniRef50_UPI000150A7E9 Cluster: Elongation factor Tu C-terminal ...   110   3e-23
UniRef50_A4R2K6 Cluster: Putative uncharacterized protein; n=1; ...   110   3e-23
UniRef50_Q8SS29 Cluster: TRANSLATION ELONGATION FACTOR 1 ALPHA; ...   109   7e-23
UniRef50_Q6JIY6 Cluster: Translation elongation factor 1 alpha; ...   108   1e-22
UniRef50_Q7YZN9 Cluster: Eukaryotic release factor 3; n=2; Dicty...   108   2e-22
UniRef50_Q7YZN7 Cluster: Hsp70 subfamily B suppressor 1; n=3; Di...   107   2e-22
UniRef50_Q2GS47 Cluster: Putative uncharacterized protein; n=1; ...   106   6e-22
UniRef50_Q9NCN5 Cluster: Eukaryotic release factor 3 GTPase subu...   105   9e-22
UniRef50_A2FN77 Cluster: Elongation factor Tu C-terminal domain ...   105   9e-22
UniRef50_Q9NCN6 Cluster: Eukaryotic release factor 3 GTPase subu...   105   1e-21
UniRef50_Q4P6P7 Cluster: Putative uncharacterized protein; n=1; ...   104   2e-21
UniRef50_O74774 Cluster: Elongation factor 1 alpha related prote...   103   5e-21
UniRef50_Q95UT7 Cluster: Elongation factor 1 alpha short form; n...   102   1e-20
UniRef50_Q23TC1 Cluster: Elongation factor Tu C-terminal domain ...   101   1e-20
UniRef50_Q9LM39 Cluster: T10O22.4; n=7; Magnoliophyta|Rep: T10O2...   101   2e-20
UniRef50_P32769 Cluster: Elongation factor 1 alpha-like protein;...   101   2e-20
UniRef50_Q4E4V1 Cluster: Elongation factor 1-alpha (EF-1-alpha),...   101   2e-20
UniRef50_Q4FW53 Cluster: Hsp70 subfamily B suppressor 1; n=3; Le...   100   4e-20
UniRef50_A0E926 Cluster: Chromosome undetermined scaffold_84, wh...   100   4e-20
UniRef50_Q5KLM5 Cluster: Putative uncharacterized protein; n=2; ...    99   6e-20
UniRef50_UPI00006CC36B Cluster: Elongation factor Tu C-terminal ...    99   1e-19
UniRef50_Q8SRN3 Cluster: TRANSLATION ELONGATION FACTOR 1-ALPHA; ...    98   2e-19
UniRef50_A5JHE1 Cluster: Translation elongation factor EF-1 alph...    97   3e-19
UniRef50_A5X901 Cluster: Elongation factor 1-alpha; n=2; Chilodo...    96   7e-19
UniRef50_Q2ABX8 Cluster: Elongation factor 1-alpha; n=1; Megacop...    92   1e-17
UniRef50_Q6CFF3 Cluster: Similar to tr|Q9WTY5 Mus musculus ERFS;...    91   3e-17
UniRef50_Q97MT1 Cluster: GTPase, sulfate adenylate transferase s...    88   2e-16
UniRef50_A4XJZ8 Cluster: Sulfate adenylyltransferase, large subu...    84   4e-15
UniRef50_A6TTV2 Cluster: Sulfate adenylyltransferase, large subu...    83   5e-15
UniRef50_Q89UE2 Cluster: NodQ bifunctional enzyme; n=12; Rhizobi...    83   9e-15
UniRef50_Q24TA2 Cluster: Adenylylsulfate kinase/sulfate adenylyl...    82   1e-14
UniRef50_A4RWT6 Cluster: Predicted protein; n=2; Ostreococcus|Re...    82   1e-14
UniRef50_UPI0000499770 Cluster: elongation factor-1alpha; n=1; E...    81   3e-14
UniRef50_A0BL72 Cluster: Chromosome undetermined scaffold_113, w...    80   5e-14
UniRef50_Q8IE20 Cluster: Elongation factor tu, putative; n=9; Ac...    79   1e-13
UniRef50_Q74CF6 Cluster: Elongation factor Tu GTP binding domain...    78   3e-13
UniRef50_Q7R087 Cluster: GLP_56_7099_8961; n=2; Giardia intestin...    77   3e-13
UniRef50_UPI0000F308E4 Cluster: UPI0000F308E4 related cluster; n...    77   5e-13
UniRef50_Q259E7 Cluster: H0801D08.2 protein; n=5; Oryza sativa|R...    76   1e-12
UniRef50_UPI0000EB403C Cluster: UPI0000EB403C related cluster; n...    75   2e-12
UniRef50_Q5CWA0 Cluster: HBS1 eRFS. GTpase; n=2; Cryptosporidium...    73   6e-12
UniRef50_Q19AS6 Cluster: Translation elongation factor 1 alpha; ...    73   6e-12
UniRef50_Q5FSE8 Cluster: Sulfate adenylyltransferase subunit 1 /...    73   1e-11
UniRef50_Q46516 Cluster: ORFC 179; n=1; Desulfurococcus mobilis|...    72   2e-11
UniRef50_A4LX06 Cluster: Sulfate adenylyltransferase; n=1; Geoba...    71   3e-11
UniRef50_Q7M9D1 Cluster: GTPASE, SULFATE ADENYLATE TRANSFERASE S...    71   4e-11
UniRef50_P02992 Cluster: Elongation factor Tu, mitochondrial pre...    71   4e-11
UniRef50_Q82L80 Cluster: Putative sulfate adenylyltransferase la...    70   5e-11
UniRef50_Q8WT68 Cluster: Elongation factor-1 alpha; n=3; Endopte...    70   7e-11
UniRef50_Q0YG57 Cluster: Small GTP-binding protein domain:Sulfat...    69   9e-11
UniRef50_Q0A978 Cluster: Sulfate adenylyltransferase, large subu...    69   9e-11
UniRef50_Q96TK8 Cluster: Translation elongation factor 1 alpha; ...    69   9e-11
UniRef50_A6GJE6 Cluster: Sulfate adenylyltransferase, large subu...    69   1e-10
UniRef50_A3HVR6 Cluster: Sulfate adenylyltransferase subunit 1; ...    69   1e-10
UniRef50_Q2S507 Cluster: Sulfate adenylyltransferase, large subu...    69   2e-10
UniRef50_Q19072 Cluster: Elongation factor Tu homologue precurso...    68   2e-10
UniRef50_Q0G239 Cluster: Binfunctional sulfate adenylyltransfera...    68   3e-10
UniRef50_A4SYY3 Cluster: Sulfate adenylyltransferase, large subu...    68   3e-10
UniRef50_A0EFI6 Cluster: Elongation factor Tu; n=3; Paramecium t...    68   3e-10
UniRef50_UPI00006CBD5B Cluster: Elongation factor Tu, mitochondr...    67   4e-10
UniRef50_UPI000050FE96 Cluster: COG2895: GTPases - Sulfate adeny...    67   4e-10
UniRef50_P49411 Cluster: Elongation factor Tu, mitochondrial pre...    66   6e-10
UniRef50_Q7UMW2 Cluster: Bifunctional enzyme cysN/cysC [Includes...    66   6e-10
UniRef50_Q0EDG4 Cluster: Mitochondrial EF-Tu2; n=1; Trichinella ...    66   1e-09
UniRef50_Q8AAP9 Cluster: Sulfate adenylyltransferase subunit 1; ...    66   1e-09
UniRef50_Q10600 Cluster: Bifunctional enzyme cysN/cysC [Includes...    66   1e-09
UniRef50_Q9PD78 Cluster: Bifunctional enzyme cysN/cysC [Includes...    65   1e-09
UniRef50_Q39DS0 Cluster: Sulfate adenylyltransferase, large subu...    64   3e-09
UniRef50_Q22GX7 Cluster: Elongation factor Tu C-terminal domain ...    64   4e-09
UniRef50_P56893 Cluster: Sulfate adenylyltransferase subunit 1; ...    64   4e-09
UniRef50_Q9UVK1 Cluster: SUP35 homolog; n=1; Pichia pastoris|Rep...    63   6e-09
UniRef50_Q5BEE6 Cluster: Elongation factor Tu; n=1; Emericella n...    63   6e-09
UniRef50_Q9RGE9 Cluster: Sulfate adenylyltransferase subunit Cys...    63   8e-09
UniRef50_Q1ITG6 Cluster: Sulfate adenylyltransferase, large subu...    63   8e-09
UniRef50_A4VDD2 Cluster: Elongation factor 1-alpha; n=1; Tetrahy...    63   8e-09
UniRef50_O83217 Cluster: Elongation factor Tu; n=7; cellular org...    63   8e-09
UniRef50_P91150 Cluster: Tu elongation factor (Ef-tu), mitochond...    62   2e-08
UniRef50_A6GM01 Cluster: Bifunctional sulfate adenylyltransferas...    61   2e-08
UniRef50_Q9UVK0 Cluster: SUP35 homolog; n=1; Saccharomycodes lud...    61   2e-08
UniRef50_Q9L9U8 Cluster: Putative ATP sulfurylase large subunit;...    61   3e-08
UniRef50_Q25820 Cluster: Elongation factor Tu; n=99; cellular or...    60   4e-08
UniRef50_Q0SH95 Cluster: CysN/CysC bifunctional enzyme; n=14; Ac...    60   6e-08
UniRef50_Q8ZBP2 Cluster: Sulfate adenylyltransferase subunit 1; ...    60   6e-08
UniRef50_Q4G4A5 Cluster: Elongation factor 1A; n=86; Eukaryota|R...    59   1e-07
UniRef50_Q8TYZ3 Cluster: GTPase-translation elongation factor; n...    59   1e-07
UniRef50_A2WJZ4 Cluster: Putative uncharacterized protein; n=1; ...    58   3e-07
UniRef50_Q83JX8 Cluster: Sulfate adenylyltransferase subunit 1; ...    58   3e-07
UniRef50_Q8ZMF5 Cluster: Sulfate adenylyltransferase subunit 1; ...    57   4e-07
UniRef50_Q8NLX2 Cluster: GTPases-Sulfate adenylate transferase s...    57   5e-07
UniRef50_Q7K3V6 Cluster: Elongation factor Tu; n=7; Coelomata|Re...    57   5e-07
UniRef50_UPI00006A2885 Cluster: UPI00006A2885 related cluster; n...    56   7e-07
UniRef50_Q4QDW8 Cluster: Elongation factor TU, putative; n=5; Tr...    56   9e-07
UniRef50_Q48791 Cluster: Tetracycline resistance protein tetS (T...    56   9e-07
UniRef50_A1W6V4 Cluster: Sulfate adenylyltransferase, large subu...    56   1e-06
UniRef50_Q45W23 Cluster: Tuf1; n=1; uncultured Pseudonocardia sp...    55   2e-06
UniRef50_A7QN79 Cluster: Chromosome undetermined scaffold_131, w...    55   2e-06
UniRef50_Q5GBH8 Cluster: TetT; n=2; Lactobacillales|Rep: TetT - ...    54   3e-06
UniRef50_A7PCT1 Cluster: Chromosome chr17 scaffold_12, whole gen...    54   5e-06
UniRef50_Q5WBK2 Cluster: Translation elongation factor G; n=1; B...    52   1e-05
UniRef50_Q8F2N6 Cluster: Peptide chain release factor 3; n=8; Ba...    52   1e-05
UniRef50_Q08RF5 Cluster: CysN/CysC bifunctional enzyme; n=2; Cys...    52   2e-05
UniRef50_P18905 Cluster: Elongation factor Tu; n=2; Coleochaetal...    52   2e-05
UniRef50_Q4JIN1 Cluster: Selenocysteine-specific translation elo...    51   3e-05
UniRef50_A0JZN0 Cluster: Sulfate adenylyltransferase, large subu...    51   3e-05
UniRef50_Q8TVI5 Cluster: Translation elongation factor, GTPase; ...    51   3e-05
UniRef50_Q1FK57 Cluster: Small GTP-binding protein domain:Sulfat...    50   4e-05
UniRef50_Q46306 Cluster: Tetracycline resistance protein tetP (T...    50   4e-05
UniRef50_Q7UN30 Cluster: Elongation factor G; n=2; Planctomyceta...    50   6e-05
UniRef50_A7Q762 Cluster: Chromosome chr5 scaffold_58, whole geno...    50   6e-05
UniRef50_Q8I592 Cluster: Elongation factor g, putative; n=1; Pla...    50   6e-05
UniRef50_Q24BY4 Cluster: Elongation factor Tu GTP binding domain...    50   6e-05
UniRef50_Q67MT5 Cluster: Peptide chain release factor 3; n=13; B...    50   6e-05
UniRef50_A1ZR77 Cluster: Translation elongation factor G; n=2; B...    50   8e-05
UniRef50_Q4Y6S3 Cluster: Elongation factor g, putative; n=4; Pla...    50   8e-05
UniRef50_Q55002 Cluster: Oxytetracycline resistance protein; n=2...    50   8e-05
UniRef50_A7ANX2 Cluster: Elongation factor Tu GTP binding domain...    49   1e-04
UniRef50_P0A3B4 Cluster: GTP-binding protein typA/bipA; n=97; Ba...    49   1e-04
UniRef50_Q6MAV2 Cluster: Probable peptide chain release factor 3...    49   1e-04
UniRef50_Q4U972 Cluster: Translation elongation factor 1-alpha, ...    49   1e-04
UniRef50_Q1VQ31 Cluster: Tetracycline resistance protein; n=1; P...    48   2e-04
UniRef50_Q1MPY9 Cluster: Selenocysteine-specific translation elo...    48   2e-04
UniRef50_A3LLY2 Cluster: GTP-binding protein LepA; n=4; Bacteria...    48   2e-04
UniRef50_Q57918 Cluster: Selenocysteine-specific elongation fact...    48   2e-04
UniRef50_A7PSI5 Cluster: Chromosome chr6 scaffold_28, whole geno...    48   3e-04
UniRef50_Q7Q3I6 Cluster: ENSANGP00000010178; n=1; Anopheles gamb...    48   3e-04
UniRef50_UPI0000519D80 Cluster: PREDICTED: similar to mitochondr...    47   4e-04
UniRef50_Q6WZ47 Cluster: Elongation factor-1 alpha; n=3; Coeloma...    47   4e-04
UniRef50_Q8UFQ0 Cluster: Tetracycline resistance protein, tetM/t...    47   4e-04
UniRef50_Q73LA2 Cluster: Selenocysteine-specific translation elo...    47   4e-04
UniRef50_A5Z9F8 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_A0YH51 Cluster: Selenocysteine-specific elongation fact...    47   4e-04
UniRef50_A5DTX8 Cluster: Putative uncharacterized protein; n=3; ...    47   4e-04
UniRef50_P73473 Cluster: Peptide chain release factor 3; n=49; B...    47   4e-04
UniRef50_Q81NX9 Cluster: GTP-binding elongation factor protein, ...    47   6e-04
UniRef50_Q67QI5 Cluster: Selenocysteine-specific elongation fact...    47   6e-04
UniRef50_A4FHF5 Cluster: Tetracycline resistance protein; n=1; S...    47   6e-04
UniRef50_Q89AC9 Cluster: GTP-binding protein TypA/BipA homolog; ...    47   6e-04
UniRef50_Q92IQ1 Cluster: GTP-binding protein lepA; n=187; Bacter...    47   6e-04
UniRef50_UPI0000D62D3D Cluster: UPI0000D62D3D related cluster; n...    46   7e-04
UniRef50_A1HSM1 Cluster: Selenocysteine-specific translation elo...    46   7e-04
UniRef50_Q6AJD2 Cluster: Peptide chain release factor 3; n=41; B...    46   7e-04
UniRef50_A6CK31 Cluster: Selenocysteine-specific translation elo...    46   0.001
UniRef50_A0UWB2 Cluster: Small GTP-binding protein; n=14; Bacter...    46   0.001
UniRef50_Q7Q1K8 Cluster: ENSANGP00000010217; n=2; Coelomata|Rep:...    46   0.001
UniRef50_Q6CBI0 Cluster: Yarrowia lipolytica chromosome C of str...    46   0.001
UniRef50_A5HWL3 Cluster: Elongation factor 1-alpha; n=6; Gloeopo...    46   0.001
UniRef50_A7H0F4 Cluster: Selenocysteine-specific translation elo...    46   0.001
UniRef50_A0Q2C8 Cluster: Translation elongation factor G; n=1; C...    46   0.001
UniRef50_Q46497 Cluster: Selenocysteine-specific elongation fact...    46   0.001
UniRef50_Q7VI67 Cluster: Selenocysteine-specific elongation fact...    45   0.002
UniRef50_Q30SC0 Cluster: Translation elongation factor, selenocy...    45   0.002
UniRef50_Q9AIG7 Cluster: Elongation factor G; n=2; Candidatus Ca...    45   0.002
UniRef50_Q1IY97 Cluster: Peptide chain release factor 3; n=1; De...    45   0.002
UniRef50_Q1ETS8 Cluster: Translation elongation factor, selenocy...    45   0.002
UniRef50_A7CTC1 Cluster: Peptide chain release factor 3; n=2; Ba...    45   0.002
UniRef50_A7QC01 Cluster: Chromosome chr10 scaffold_76, whole gen...    45   0.002
UniRef50_P44910 Cluster: GTP-binding protein typA/bipA homolog; ...    45   0.002
UniRef50_Q969S9-2 Cluster: Isoform 2 of Q969S9 ; n=8; Tetrapoda|...    45   0.002
UniRef50_A3SGF9 Cluster: Translation elongation factor, selenocy...    45   0.002
UniRef50_A5KED2 Cluster: Elongation factor, putative; n=1; Plasm...    45   0.002
UniRef50_A6SB62 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q02652 Cluster: Tetracycline resistance protein tetM; n...    45   0.002
UniRef50_Q5FLA9 Cluster: Peptide chain release factor 3; n=66; B...    45   0.002
UniRef50_Q969S9 Cluster: Elongation factor G 2, mitochondrial pr...    45   0.002
UniRef50_Q6ML87 Cluster: PrfC protein; n=1; Bdellovibrio bacteri...    44   0.003
UniRef50_A2XIM0 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_Q8I568 Cluster: TetQ family GTPase, putative; n=1; Plas...    44   0.003
UniRef50_Q5FMW9 Cluster: Translation elongation factors; n=2; La...    44   0.004
UniRef50_A5K8L7 Cluster: TetQ family GTPase, putative; n=1; Plas...    44   0.004
UniRef50_Q8SQT7 Cluster: TRANSLATION ELONGATION FACTOR 2; n=3; M...    44   0.004
UniRef50_Q837X4 Cluster: Peptide chain release factor 3; n=47; F...    44   0.004
UniRef50_Q73R08 Cluster: Elongation factor G 1; n=2; Treponema|R...    44   0.004
UniRef50_Q8I335 Cluster: GTP-binding protein, putative; n=1; Pla...    44   0.005
UniRef50_P39677 Cluster: Elongation factor G 2, mitochondrial pr...    44   0.005
UniRef50_UPI0000E46328 Cluster: PREDICTED: similar to G elongati...    43   0.007
UniRef50_Q8XIK3 Cluster: Selenocysteine-specific elongation fact...    43   0.007
UniRef50_Q1NNQ3 Cluster: Small GTP-binding protein domain; n=4; ...    43   0.007
UniRef50_Q18YZ1 Cluster: Selenocysteine-specific translation elo...    43   0.007
UniRef50_Q4Q2R0 Cluster: Selenocysteine-specific elongation fact...    43   0.007
UniRef50_Q2RJM5 Cluster: Translation initiation factor IF-2; n=3...    40   0.008
UniRef50_UPI0000D56919 Cluster: PREDICTED: similar to CG31159-PA...    43   0.009
UniRef50_Q931D5 Cluster: SelB selenocysteine-specific elongation...    43   0.009
UniRef50_Q3E0L1 Cluster: Translation elongation factor, selenocy...    43   0.009
UniRef50_Q2B7L6 Cluster: Selenocysteine-specific translation elo...    43   0.009
UniRef50_A6BIM9 Cluster: Putative uncharacterized protein; n=1; ...    43   0.009
UniRef50_A7PFT2 Cluster: Chromosome chr11 scaffold_14, whole gen...    43   0.009
UniRef50_Q384D0 Cluster: Elongation factor G2-like protein; n=5;...    43   0.009
UniRef50_A0D5J3 Cluster: Chromosome undetermined scaffold_39, wh...    43   0.009
UniRef50_A3LWR2 Cluster: Mitochondrial elongation factor G-like ...    43   0.009
UniRef50_UPI000050FBE9 Cluster: COG3276: Selenocysteine-specific...    42   0.012
UniRef50_Q1GFM6 Cluster: Peptide chain release factor 3; n=41; P...    42   0.012
UniRef50_A7HB64 Cluster: Translation elongation factor G; n=2; A...    42   0.012
UniRef50_A4X2G5 Cluster: Selenocysteine-specific translation elo...    42   0.012
UniRef50_A0KL71 Cluster: Selenocysteine-specific translation elo...    42   0.012
UniRef50_Q9VCX4 Cluster: CG31159-PA; n=4; Diptera|Rep: CG31159-P...    42   0.012
UniRef50_Q96RP9 Cluster: Elongation factor G 1, mitochondrial pr...    42   0.012
UniRef50_A5D2S0 Cluster: Translation initiation factor 2; n=5; C...    40   0.013
UniRef50_Q6G589 Cluster: Peptide chain release factor 3; n=14; A...    42   0.016
UniRef50_Q6AKJ8 Cluster: Probable elongation factor G; n=1; Desu...    42   0.016
UniRef50_Q2LU53 Cluster: Selenocysteine-specific protein transla...    42   0.016
UniRef50_A5ZXF5 Cluster: Putative uncharacterized protein; n=2; ...    42   0.016
UniRef50_Q55G92 Cluster: Putative uncharacterized protein; n=1; ...    42   0.016
UniRef50_Q4Y0B9 Cluster: TetQ family GTPase, putative; n=5; Plas...    42   0.016
UniRef50_Q22A26 Cluster: Elongation factor Tu GTP binding domain...    42   0.016
UniRef50_A7AQT2 Cluster: Elongation factor G 2, mitochondrial, p...    42   0.016
UniRef50_Q7URR0 Cluster: Translation initiation factor IF-2; n=1...    42   0.016
UniRef50_Q8EWU0 Cluster: Translation initiation factor IF-2; n=2...    42   0.016
UniRef50_Q1IHM2 Cluster: Selenocysteine-specific translation elo...    42   0.021
UniRef50_A6PUV8 Cluster: Small GTP-binding protein; n=1; Victiva...    42   0.021
UniRef50_A1I9J9 Cluster: Translation elongation factor G; n=1; C...    42   0.021
UniRef50_Q7R7M3 Cluster: Elongation factor Tu family, putative; ...    42   0.021
UniRef50_A3FPW4 Cluster: Elongation factor-like protein; n=3; Cr...    42   0.021
UniRef50_Q606M6 Cluster: Peptide chain release factor 3; n=3; Pr...    42   0.021
UniRef50_Q7WHG2 Cluster: Translation initiation factor IF-2; n=2...    42   0.021
UniRef50_A7I3V0 Cluster: Translation initiation factor IF-2; n=1...    38   0.023
UniRef50_Q4QBM3 Cluster: Translation initiation factor IF-2, put...    35   0.023
UniRef50_UPI0000E87FA9 Cluster: translation initiation factor IF...    41   0.027
UniRef50_Q72IJ8 Cluster: Translation elongation and release fact...    41   0.027
UniRef50_Q1Q1G5 Cluster: Strongly similar to translation initiat...    41   0.027
UniRef50_Q1AUJ9 Cluster: Selenocysteine-specific translation elo...    41   0.027
UniRef50_A7CUV7 Cluster: Translation elongation factor G; n=1; O...    41   0.027
UniRef50_A6DB59 Cluster: Putative selenocysteine-specific elonga...    41   0.027
UniRef50_A6CF43 Cluster: Translation initiation factor IF-2; n=1...    41   0.027
UniRef50_Q74NG5 Cluster: NEQ270; n=1; Nanoarchaeum equitans|Rep:...    41   0.027
UniRef50_P34617 Cluster: Uncharacterized GTP-binding protein ZK1...    41   0.027
UniRef50_P43927 Cluster: Selenocysteine-specific elongation fact...    41   0.027
UniRef50_Q9PGX4 Cluster: Peptide chain release factor 3; n=302; ...    41   0.027
UniRef50_Q8F7K1 Cluster: Translation initiation factor IF-2; n=4...    41   0.027
UniRef50_P34811 Cluster: Elongation factor G, chloroplast precur...    41   0.027
UniRef50_Q7VHF6 Cluster: Translation initiation factor IF-2; n=1...    38   0.030
UniRef50_Q663U2 Cluster: Selenocysteine-specific elongation fact...    41   0.036
UniRef50_Q1FLN1 Cluster: Small GTP-binding protein domain; n=10;...    41   0.036
UniRef50_Q0LF89 Cluster: Selenocysteine-specific translation elo...    41   0.036
UniRef50_A0Z3R3 Cluster: Selenocysteine-specific elongation fact...    41   0.036
UniRef50_Q7RJ38 Cluster: Elongation factor Tu family, putative; ...    41   0.036
UniRef50_P70882 Cluster: Tetracycline resistance protein tetQ (T...    41   0.036
UniRef50_Q5QXU1 Cluster: Peptide chain release factor 3; n=5; Ga...    41   0.036
UniRef50_Q660H9 Cluster: Elongation factor G 2; n=3; Borrelia bu...    41   0.036
UniRef50_Q8C3X4-2 Cluster: Isoform 2 of Q8C3X4 ; n=3; Murinae|Re...    40   0.048
UniRef50_Q9AA65 Cluster: Elongation factor Tu family protein; n=...    40   0.048
UniRef50_Q97KR3 Cluster: Tetracycline resistance protein tetP, c...    40   0.048
UniRef50_Q6LH28 Cluster: Hypothetical selenocysteine-specific tr...    40   0.048
UniRef50_Q2YZV2 Cluster: Translation elongation factor G; n=1; u...    40   0.048
UniRef50_Q1NKM4 Cluster: Translation elongation factor, selenocy...    40   0.048
UniRef50_Q9LS91 Cluster: Elongation factor EF-2; n=1; Arabidopsi...    40   0.048
UniRef50_A5K6I6 Cluster: GTP-binding protein, putative; n=2; cel...    40   0.048
UniRef50_Q9WZN3 Cluster: Translation initiation factor IF-2; n=5...    40   0.048
UniRef50_Q5QTY8 Cluster: Translation initiation factor IF-2; n=1...    40   0.048
UniRef50_Q9RTG5 Cluster: Translation initiation factor IF-2; n=4...    40   0.048
UniRef50_Q6F0Z6 Cluster: GTP-binding membrane protein, elongatio...    40   0.063
UniRef50_Q0ATV7 Cluster: Selenocysteine-specific translation elo...    40   0.063
UniRef50_A6Q226 Cluster: Translation initiation factor IF-2; n=5...    40   0.063
UniRef50_A6GK83 Cluster: Translation initiation factor IF-2; n=1...    40   0.063
UniRef50_A4E859 Cluster: Putative uncharacterized protein; n=1; ...    40   0.063
UniRef50_A1SQK9 Cluster: Small GTP-binding protein; n=2; Actinom...    40   0.063
UniRef50_Q4Q219 Cluster: Mitochondrial elongation factor G, puta...    40   0.063
UniRef50_Q8R5Z1 Cluster: Translation initiation factor IF-2; n=3...    40   0.063
UniRef50_O94429 Cluster: Elongation factor G 2, mitochondrial pr...    40   0.063
UniRef50_Q0AXN1 Cluster: Elongation factor G 1; n=1; Syntrophomo...    40   0.063
UniRef50_P13639 Cluster: Elongation factor 2; n=491; Eukaryota|R...    40   0.063
UniRef50_Q7VQM3 Cluster: Translation initiation factor IF-2; n=2...    37   0.066
UniRef50_UPI0000DB7182 Cluster: PREDICTED: similar to elongation...    40   0.084
UniRef50_Q2GDP0 Cluster: Translation initiation factor IF-2; n=1...    40   0.084
UniRef50_Q9XD39 Cluster: Elongation factor G; n=5; Leptospira|Re...    40   0.084
UniRef50_A6DBA3 Cluster: Translation initiation factor IF-2; n=1...    40   0.084
UniRef50_A6C5F4 Cluster: Elongation factor G; n=1; Planctomyces ...    40   0.084
UniRef50_A5KIG4 Cluster: Putative uncharacterized protein; n=1; ...    40   0.084
UniRef50_A0LHL0 Cluster: Selenocysteine-specific translation elo...    40   0.084
UniRef50_A7PJC5 Cluster: Chromosome chr12 scaffold_18, whole gen...    40   0.084
UniRef50_A5AF37 Cluster: Putative uncharacterized protein; n=1; ...    40   0.084
UniRef50_A0DB90 Cluster: Chromosome undetermined scaffold_44, wh...    40   0.084
UniRef50_A2R994 Cluster: Contig An17c0030, complete genome; n=1;...    40   0.084
UniRef50_Q8D2X6 Cluster: Translation initiation factor IF-2; n=1...    40   0.084
UniRef50_Q3ZXU3 Cluster: Translation initiation factor IF-2; n=8...    40   0.084
UniRef50_Q5PAJ5 Cluster: Translation initiation factor IF-2; n=3...    40   0.084
UniRef50_Q6IRN1 Cluster: MGC83880 protein; n=7; Coelomata|Rep: M...    39   0.11 
UniRef50_Q74GZ1 Cluster: Selenocysteine-specific translation elo...    39   0.11 
UniRef50_Q1Z854 Cluster: Hypothetical selenocysteine-specific tr...    39   0.11 
UniRef50_Q0BZB1 Cluster: Selenocysteine-specific translation elo...    39   0.11 
UniRef50_Q00ZZ1 Cluster: GTP-binding membrane protein LepA homol...    39   0.11 
UniRef50_A0BK03 Cluster: Chromosome undetermined scaffold_111, w...    39   0.11 
UniRef50_P55875 Cluster: Translation initiation factor IF-2; n=7...    39   0.11 
UniRef50_Q4FVL5 Cluster: Translation initiation factor IF-2; n=1...    39   0.11 
UniRef50_P55972 Cluster: Translation initiation factor IF-2; n=5...    39   0.11 
UniRef50_Q8N442 Cluster: GTP-binding protein GUF1 homolog; n=108...    39   0.11 
UniRef50_Q7MA53 Cluster: Elongation factor G; n=36; Bacteria|Rep...    39   0.11 
UniRef50_Q8F983 Cluster: Elongation factor G; n=98; cellular org...    39   0.11 
UniRef50_O07170 Cluster: Elongation factor G-like protein; n=24;...    39   0.11 
UniRef50_Q1ZC67 Cluster: Selenocysteine synthase; n=1; Psychromo...    39   0.15 
UniRef50_A1FR56 Cluster: Translation elongation factor G; n=1; S...    39   0.15 
UniRef50_A0YGX4 Cluster: Translation elongation factor, selenocy...    39   0.15 
UniRef50_Q98RS6 Cluster: U5 small nuclear ribonucleoprotein 116 ...    39   0.15 
UniRef50_Q6ESY0 Cluster: Putative elongation factor 2; n=2; Oryz...    39   0.15 
UniRef50_A4RX89 Cluster: Predicted protein; n=2; Ostreococcus|Re...    39   0.15 
UniRef50_Q9W2H0 Cluster: CG9841-PA; n=1; Drosophila melanogaster...    39   0.15 
UniRef50_P14081 Cluster: Selenocysteine-specific elongation fact...    39   0.15 
UniRef50_Q9PGR3 Cluster: Translation initiation factor IF-2; n=2...    39   0.15 
UniRef50_Q67P86 Cluster: Translation initiation factor IF-2; n=1...    39   0.15 
UniRef50_Q8TXJ4 Cluster: Elongation factor 2 (EF-2) [Contains: M...    39   0.15 
UniRef50_UPI0000DA1A06 Cluster: PREDICTED: similar to elongation...    38   0.19 
UniRef50_UPI00004996CE Cluster: 116 kda u5 small nuclear ribonuc...    38   0.19 
UniRef50_Q47F25 Cluster: Translation elongation factor, selenocy...    38   0.19 
UniRef50_A6QBQ5 Cluster: Translation initiation factor IF-2; n=1...    38   0.19 
UniRef50_A3Q882 Cluster: Selenocysteine-specific translation elo...    38   0.19 
UniRef50_Q95Y73 Cluster: Putative uncharacterized protein; n=2; ...    38   0.19 
UniRef50_Q583L1 Cluster: Selenocysteine-tRNA-specific elongation...    38   0.19 
UniRef50_A7S2I1 Cluster: Predicted protein; n=1; Nematostella ve...    38   0.19 
UniRef50_Q4FNM9 Cluster: Translation initiation factor IF-2; n=2...    38   0.19 
UniRef50_Q609C0 Cluster: Translation initiation factor IF-2; n=8...    38   0.19 
UniRef50_Q72ER1 Cluster: Translation initiation factor IF-2; n=3...    38   0.19 
UniRef50_Q39SN2 Cluster: Elongation factor G 2; n=4; Bacteria|Re...    38   0.19 
UniRef50_O67141 Cluster: Elongation factor SelB; n=1; Aquifex ae...    38   0.26 
UniRef50_A6P2V2 Cluster: Putative uncharacterized protein; n=1; ...    38   0.26 
UniRef50_A1AV99 Cluster: Translation initiation factor IF-2; n=3...    38   0.26 
UniRef50_Q20447 Cluster: Putative uncharacterized protein; n=2; ...    38   0.26 
UniRef50_P17889 Cluster: Translation initiation factor IF-2; n=6...    38   0.26 
UniRef50_O87844 Cluster: Elongation factor G 2; n=2; Streptomyce...    38   0.26 
UniRef50_Q4T508 Cluster: Chromosome 1 SCAF9472, whole genome sho...    38   0.34 
UniRef50_Q30SS6 Cluster: Initiation factor 2; n=1; Thiomicrospir...    38   0.34 
UniRef50_A5ZAJ3 Cluster: Putative uncharacterized protein; n=1; ...    38   0.34 
UniRef50_A5UZQ2 Cluster: Translation initiation factor IF-2; n=5...    38   0.34 
UniRef50_A4E707 Cluster: Putative uncharacterized protein; n=1; ...    38   0.34 
UniRef50_Q7XQQ7 Cluster: OSJNBa0091D06.15 protein; n=66; cellula...    38   0.34 
UniRef50_A2EAD8 Cluster: Elongation factor Tu GTP binding domain...    38   0.34 
UniRef50_Q2IJP9 Cluster: Peptide chain release factor 3; n=2; Ba...    37   0.45 
UniRef50_Q0S473 Cluster: Elongation factor EF2; n=1; Rhodococcus...    37   0.45 
UniRef50_Q0AYI8 Cluster: Translation initiation factor IF-2; n=1...    37   0.45 
UniRef50_A6NTY0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.45 
UniRef50_A6G5J6 Cluster: Translation initiation factor IF-2; n=1...    37   0.45 
UniRef50_A1FN34 Cluster: Selenocysteine-specific translation elo...    37   0.45 
UniRef50_A7PLZ9 Cluster: Chromosome chr14 scaffold_21, whole gen...    37   0.45 
UniRef50_A5JZM2 Cluster: GTP-binding protein TypA, putative; n=7...    37   0.45 
UniRef50_A1DDI0 Cluster: Ribosome biogenesis protein Ria1, putat...    37   0.45 
UniRef50_Q97S57 Cluster: Translation initiation factor IF-2; n=9...    37   0.45 
UniRef50_Q74CT3 Cluster: Translation initiation factor IF-2; n=2...    37   0.45 
UniRef50_Q30WJ0 Cluster: Translation initiation factor IF-2; n=1...    37   0.45 
UniRef50_Q9HWD2 Cluster: Elongation factor G 1; n=46; Bacteria|R...    37   0.45 
UniRef50_Q9PKU0 Cluster: Translation initiation factor IF-2; n=1...    34   0.55 
UniRef50_Q9RXC2 Cluster: Elongation factor G; n=2; Deinococcus|R...    37   0.59 
UniRef50_Q3ZYA7 Cluster: Translation elongation factor G; n=4; B...    37   0.59 
UniRef50_Q1ZR84 Cluster: Selenocysteinyl-tRNA-specific translati...    37   0.59 
UniRef50_A7HHY2 Cluster: Selenocysteine-specific translation elo...    37   0.59 
UniRef50_A0NL43 Cluster: Translation initiation factor 2; n=2; O...    37   0.59 
UniRef50_Q0E3S2 Cluster: Os02g0157700 protein; n=4; cellular org...    37   0.59 
UniRef50_Q22AK9 Cluster: Translation elongation factor G; n=3; O...    37   0.59 
UniRef50_A0BTU2 Cluster: Chromosome undetermined scaffold_128, w...    37   0.59 
UniRef50_A6S9S7 Cluster: Putative uncharacterized protein; n=1; ...    37   0.59 
UniRef50_A4YIX9 Cluster: Protein synthesis factor, GTP-binding; ...    37   0.59 
UniRef50_Q46455 Cluster: Selenocysteine-specific elongation fact...    37   0.59 
UniRef50_Q6MTQ0 Cluster: Translation initiation factor IF-2; n=2...    37   0.59 
UniRef50_Q6AJY4 Cluster: Translation initiation factor IF-2; n=3...    37   0.59 
UniRef50_O36041 Cluster: Eukaryotic translation initiation facto...    37   0.59 
UniRef50_Q9X1Y4 Cluster: Elongation factor G-like protein; n=5; ...    37   0.59 
UniRef50_Q0HP29 Cluster: Selenocysteine-specific translation elo...    36   0.78 
UniRef50_A6G6E0 Cluster: Protein translation elongation factor G...    36   0.78 
UniRef50_A6CUD1 Cluster: Translation initiation factor IF-2; n=1...    36   0.78 
UniRef50_A3ZU78 Cluster: Translation initiation factor; n=1; Bla...    36   0.78 
UniRef50_A2XK54 Cluster: Putative uncharacterized protein; n=3; ...    36   0.78 
UniRef50_Q98QW3 Cluster: GTP-binding protein lepA; n=52; cellula...    36   0.78 
UniRef50_Q2JDK2 Cluster: GTP-binding protein lepA; n=24; Actinom...    36   0.78 
UniRef50_Q5NQ27 Cluster: Translation initiation factor IF-2; n=2...    36   0.78 
UniRef50_Q73NP6 Cluster: Translation initiation factor IF-2; n=2...    36   0.78 
UniRef50_Q5FQM3 Cluster: Translation initiation factor IF-2; n=8...    36   0.78 
UniRef50_Q8FXT2 Cluster: Translation initiation factor IF-2; n=3...    36   0.78 
UniRef50_O58822 Cluster: Probable translation initiation factor ...    36   0.78 
UniRef50_Q5FDV4 Cluster: GTP-binding protein TypA/BipA homolog; ...    36   1.0  
UniRef50_A0X1J6 Cluster: Selenocysteine-specific translation elo...    36   1.0  
UniRef50_Q2XN58 Cluster: Auxin down-regulated protein; n=2; Glyc...    36   1.0  
UniRef50_Q4PDC2 Cluster: Putative uncharacterized protein; n=1; ...    36   1.0  
UniRef50_A1JVG8 Cluster: Elongation factor 1-alpha; n=2; Gibbere...    36   1.0  
UniRef50_Q5GS99 Cluster: Translation initiation factor IF-2; n=6...    36   1.0  
UniRef50_Q6YR66 Cluster: Translation initiation factor IF-2; n=3...    36   1.0  
UniRef50_A4RU91 Cluster: Chloroplast translation initiation fact...    33   1.2  
UniRef50_Q4HK10 Cluster: Selenocysteine-specific translation elo...    36   1.4  
UniRef50_A6LU84 Cluster: Small GTP-binding protein; n=1; Clostri...    36   1.4  
UniRef50_A6EB22 Cluster: Translation initiation factor IF-2; n=2...    36   1.4  
UniRef50_A7QSS1 Cluster: Chromosome chr4 scaffold_162, whole gen...    36   1.4  
UniRef50_Q9VAX8 Cluster: CG4849-PA; n=6; Eukaryota|Rep: CG4849-P...    36   1.4  
UniRef50_A1CA46 Cluster: Translation elongation factor G2, putat...    36   1.4  
UniRef50_O51115 Cluster: GTP-binding protein lepA; n=9; Bacteria...    36   1.4  
UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=5...    36   1.4  
UniRef50_Q8TJT7 Cluster: Translation initiation factor 2 subunit...    36   1.4  
UniRef50_Q8R7R5 Cluster: Translation elongation and release fact...    35   1.8  
UniRef50_Q7MVV0 Cluster: Translation elongation factor G, putati...    35   1.8  
UniRef50_Q0HFP5 Cluster: Transcriptional regulator, LysR family;...    35   1.8  
UniRef50_A5CEN6 Cluster: Translation initiation factor IF-2; n=1...    35   1.8  
UniRef50_A4A194 Cluster: Small GTP-binding protein domain; n=1; ...    35   1.8  
UniRef50_A0JYS6 Cluster: GTP-binding protein TypA; n=101; Bacter...    35   1.8  
UniRef50_Q4N072 Cluster: GTP-binding elongation factor, putative...    35   1.8  
UniRef50_Q6BVE5 Cluster: Debaryomyces hansenii chromosome C of s...    35   1.8  
UniRef50_A2R3P3 Cluster: Contig An14c0170, complete genome; n=7;...    35   1.8  
UniRef50_Q4JA97 Cluster: GTP-binding protein 1; n=4; Sulfolobace...    35   1.8  
UniRef50_Q7VA20 Cluster: Translation initiation factor IF-2; n=2...    35   1.8  
UniRef50_Q74IS8 Cluster: Translation initiation factor IF-2; n=3...    35   1.8  
UniRef50_Q5HB61 Cluster: Translation initiation factor IF-2; n=6...    35   1.8  
UniRef50_O29490 Cluster: Probable translation initiation factor ...    35   1.8  
UniRef50_P0A557 Cluster: Elongation factor G; n=248; Bacteria|Re...    35   1.8  
UniRef50_Q74A61 Cluster: Elongation factor G 1; n=6; Desulfuromo...    35   1.8  
UniRef50_Q8KFT1 Cluster: Translation initiation factor IF-2; n=1...    32   2.1  
UniRef50_Q8G811 Cluster: Putative uncharacterized protein; n=2; ...    35   2.4  
UniRef50_Q1JYY0 Cluster: Selenocysteine-specific translation elo...    35   2.4  
UniRef50_Q0EZ74 Cluster: Translation initiation factor IF-2; n=1...    35   2.4  
UniRef50_A4YUJ6 Cluster: Protein chain elongation factor EF-G, G...    35   2.4  
UniRef50_A3J586 Cluster: Putative uncharacterized protein; n=3; ...    35   2.4  
UniRef50_A3ER81 Cluster: Putative translation initiation factor ...    35   2.4  
UniRef50_A2U1S4 Cluster: GTP-binding elongation factor family pr...    35   2.4  
UniRef50_Q98RT0 Cluster: Eukaryotic translation initiation facto...    35   2.4  
UniRef50_Q7QZ18 Cluster: GLP_464_49314_47878; n=2; Giardia intes...    35   2.4  
UniRef50_Q4N936 Cluster: Translation elongation factor G 2, puta...    35   2.4  
UniRef50_A3LY41 Cluster: Predicted protein; n=3; Saccharomycetac...    35   2.4  
UniRef50_Q1XDN0 Cluster: Translation initiation factor IF-2, chl...    35   2.4  
UniRef50_Q8ZZC1 Cluster: Elongation factor 2; n=17; Thermoprotei...    35   2.4  
UniRef50_UPI00015BD5D6 Cluster: UPI00015BD5D6 related cluster; n...    34   3.1  
UniRef50_A6G2B2 Cluster: Translation elongation factor, selenocy...    34   3.1  
UniRef50_A4E6U7 Cluster: Putative uncharacterized protein; n=1; ...    34   3.1  
UniRef50_A7SA88 Cluster: Predicted protein; n=1; Nematostella ve...    34   3.1  
UniRef50_A7AQ93 Cluster: GTP-binding protein LepA family protein...    34   3.1  
UniRef50_A0BPT3 Cluster: Chromosome undetermined scaffold_12, wh...    34   3.1  
UniRef50_Q6C3F7 Cluster: Similar to tr|Q12161 Saccharomyces cere...    34   3.1  
UniRef50_UPI00003933D9 Cluster: COG1217: Predicted membrane GTPa...    34   4.2  
UniRef50_Q73P52 Cluster: Translation elongation factor G, putati...    34   4.2  
UniRef50_Q2LWU6 Cluster: Bacterial protein translation Initiatio...    34   4.2  
UniRef50_A7IC08 Cluster: Translation initiation factor IF-2; n=2...    34   4.2  
UniRef50_Q4N0F2 Cluster: Translation initiation factor IF-2, put...    34   4.2  
UniRef50_Q98R05 Cluster: Translation initiation factor IF-2; n=8...    34   4.2  
UniRef50_O59683 Cluster: Translation initiation factor IF-2, mit...    34   4.2  
UniRef50_Q4S9H1 Cluster: Chromosome undetermined SCAF14696, whol...    33   5.5  
UniRef50_A6PMK2 Cluster: Translation initiation factor IF-2; n=1...    33   5.5  
UniRef50_A2VTQ7 Cluster: Elongation factor EF-Tu; n=1; Burkholde...    33   5.5  
UniRef50_A7P1C4 Cluster: Chromosome chr19 scaffold_4, whole geno...    33   5.5  
UniRef50_Q4QA83 Cluster: Elongation factor, putative; n=5; Trypa...    33   5.5  
UniRef50_A7ARF7 Cluster: GTP binding protein, putative; n=1; Bab...    33   5.5  
UniRef50_A4IBG5 Cluster: Cytochrome p450 reductase, putative; n=...    33   5.5  
UniRef50_Q2GQL9 Cluster: Putative uncharacterized protein; n=1; ...    33   5.5  
UniRef50_P47388 Cluster: Translation initiation factor IF-2; n=6...    33   5.5  
UniRef50_Q6MMS6 Cluster: Translation initiation factor IF-2; n=1...    33   5.5  
UniRef50_Q6FDS6 Cluster: Elongation factor G; n=157; cellular or...    33   5.5  
UniRef50_Q10878 Cluster: POSSIBLE FATTY-ACID-CoA LIGASE FADD10; ...    33   7.3  
UniRef50_Q4C3K5 Cluster: Putative uncharacterized protein; n=1; ...    33   7.3  
UniRef50_Q1ZVV6 Cluster: GTP-binding regulator BipA/TypA; n=4; V...    33   7.3  
UniRef50_A6C5G4 Cluster: Protein translation elongation factor G...    33   7.3  
UniRef50_A0Y0J0 Cluster: Putative uncharacterized protein; n=1; ...    33   7.3  
UniRef50_Q239N3 Cluster: Elongation factor Tu GTP binding domain...    33   7.3  
UniRef50_O77136 Cluster: Translation initiation factor 2; n=1; A...    33   7.3  
UniRef50_Q5KNR0 Cluster: GTPase, putative; n=1; Filobasidiella n...    33   7.3  
UniRef50_A7TLH4 Cluster: Putative uncharacterized protein; n=1; ...    33   7.3  
UniRef50_A6SDI5 Cluster: Putative uncharacterized protein; n=2; ...    33   7.3  
UniRef50_Q68WI4 Cluster: Translation initiation factor IF-2; n=1...    33   7.3  
UniRef50_UPI000065EB23 Cluster: Translation initiation factor IF...    33   9.6  
UniRef50_Q72B39 Cluster: Translation elongation factor G; n=3; D...    33   9.6  
UniRef50_Q4AGI8 Cluster: Elongation factor G, C-terminal:Protein...    33   9.6  
UniRef50_Q0RNV6 Cluster: Elongation factor G; n=1; Frankia alni ...    33   9.6  
UniRef50_A3TP61 Cluster: Translation elongation factor EF-G; n=1...    33   9.6  
UniRef50_A1WAT4 Cluster: Putative transmembrane protein; n=2; Co...    33   9.6  
UniRef50_A0LHL8 Cluster: Translation initiation factor IF-2; n=1...    33   9.6  
UniRef50_O82501 Cluster: F2P3.9 protein; n=7; Magnoliophyta|Rep:...    33   9.6  

>UniRef50_UPI00005A4635 Cluster: PREDICTED: similar to statin-like;
           n=2; Canis lupus familiaris|Rep: PREDICTED: similar to
           statin-like - Canis familiaris
          Length = 667

 Score =  223 bits (545), Expect = 4e-57
 Identities = 108/133 (81%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 281 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 340

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 341 DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 400

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 401 GEFEAGISKNGQT 413



 Score =  137 bits (332), Expect = 2e-31
 Identities = 63/72 (87%), Positives = 67/72 (93%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KEVS+YIKKIGYNPA V FVPI
Sbjct: 414 REHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPI 473

Query: 690 SGWHGDNMLEPS 725
           SGWHGDNMLEPS
Sbjct: 474 SGWHGDNMLEPS 485


>UniRef50_Q05639 Cluster: Elongation factor 1-alpha 2; n=8397;
           root|Rep: Elongation factor 1-alpha 2 - Homo sapiens
           (Human)
          Length = 463

 Score =  223 bits (545), Expect = 4e-57
 Identities = 108/133 (81%), Positives = 112/133 (84%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA E  K         
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 
Sbjct: 61  DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV 120

Query: 472 GEFEAGISKNGQT 510
           GEFEAGISKNGQT
Sbjct: 121 GEFEAGISKNGQT 133



 Score =  139 bits (336), Expect = 7e-32
 Identities = 64/75 (85%), Positives = 68/75 (90%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA+TLGVKQLIVGVNKMDSTEP YSE R++EI KEVS+YIKKIGYNPA V FVPI
Sbjct: 134 REHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SGWHGDNMLEPS  M
Sbjct: 194 SGWHGDNMLEPSPNM 208


>UniRef50_P13905 Cluster: Elongation factor 1-alpha; n=2224;
           cellular organisms|Rep: Elongation factor 1-alpha -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 449

 Score =  202 bits (492), Expect = 9e-51
 Identities = 99/133 (74%), Positives = 106/133 (79%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA E  K         
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct: 61  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120

Query: 472 GEFEAGISKNGQT 510
           G FEAGISK+GQT
Sbjct: 121 GGFEAGISKDGQT 133



 Score =  112 bits (270), Expect = 7e-24
 Identities = 51/75 (68%), Positives = 62/75 (82%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KEVSSY+KK+GYNP  + FVPI
Sbjct: 134 REHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SG+ GDNM+E ST +
Sbjct: 194 SGFEGDNMIERSTNL 208


>UniRef50_Q5EMT9 Cluster: Elongation factor 1-alpha-like protein;
           n=6; Fungi/Metazoa group|Rep: Elongation factor
           1-alpha-like protein - Magnaporthe grisea (Rice blast
           fungus) (Pyricularia grisea)
          Length = 473

 Score =  200 bits (489), Expect = 2e-50
 Identities = 95/131 (72%), Positives = 107/131 (81%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           KEK+H+N+VVIGHVDSGKSTTTGHLIYK  GID+RTIEK+EKEA E  K           
Sbjct: 4   KEKSHLNVVVIGHVDSGKSTTTGHLIYKLKGIDQRTIEKYEKEAAELGKGSFKYAWVLDK 63

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
            +     GITIDIALWKFET+KY VT+IDAPGHRDFIKNMITGTSQADCA+L++ AGTGE
Sbjct: 64  LKAERERGITIDIALWKFETAKYQVTVIDAPGHRDFIKNMITGTSQADCAILVIGAGTGE 123

Query: 478 FEAGISKNGQT 510
           FEAGISK+GQT
Sbjct: 124 FEAGISKDGQT 134



 Score = 95.9 bits (228), Expect = 9e-19
 Identities = 44/72 (61%), Positives = 61/72 (84%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGV+QLIV VNKMD+ +  +++ R++EI KE S+++KKIG+NP +V FVPI
Sbjct: 135 REHALLAFTLGVRQLIVAVNKMDTAK--WAQSRYDEIVKETSNFLKKIGFNPDSVPFVPI 192

Query: 690 SGWHGDNMLEPS 725
           SG++GD+M+  S
Sbjct: 193 SGFNGDHMISES 204


>UniRef50_UPI0000EB0538 Cluster: UPI0000EB0538 related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB0538 UniRef100
           entry - Canis familiaris
          Length = 357

 Score =  177 bits (432), Expect = 2e-43
 Identities = 95/135 (70%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDS--GKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           MGKE THINI+VI H     GKSTTTGHLIYKCGGIDKRTIEKFE EA E  K       
Sbjct: 1   MGKEMTHINIIVISHWMHRLGKSTTTGHLIYKCGGIDKRTIEKFE-EAAEMGKGSFRYAW 59

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                +     GIT+DI+LWKFETSKYYVTI DA GH+  IKNMITGT QADCAVLIVAA
Sbjct: 60  VLDKLKAEHEHGITVDISLWKFETSKYYVTITDATGHKH-IKNMITGTPQADCAVLIVAA 118

Query: 466 GTGEFEAGISKNGQT 510
           G GEFEAGISK GQT
Sbjct: 119 GVGEFEAGISKMGQT 133



 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 54/124 (43%), Positives = 68/124 (54%), Gaps = 4/124 (3%)
 Frame = +3

Query: 255 MGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLS 434
           MGKGSF+YAWVLDKLKAE E   H     + +   +   Y+   + T     +H    ++
Sbjct: 50  MGKGSFRYAWVLDKLKAEHE---HGITVDISLWKFETSKYY--VTITDATGHKHIKNMIT 104

Query: 435 G*LR--CAHR--SCRYR*IRSWYL*ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSE 602
           G  +  CA    +       +        REHALLA TLGVKQL+VGVNK+DSTEPPYS 
Sbjct: 105 GTPQADCAVLIVAAGVGEFEAGISKMGQTREHALLA-TLGVKQLVVGVNKIDSTEPPYSW 163

Query: 603 PRFE 614
            R E
Sbjct: 164 KRVE 167


>UniRef50_Q8IFW1 Cluster: Elongation factor-1 alpha; n=1; Exoneura
           angophorae|Rep: Elongation factor-1 alpha - Exoneura
           angophorae
          Length = 139

 Score =  174 bits (423), Expect = 2e-42
 Identities = 91/136 (66%), Positives = 103/136 (75%)
 Frame = +3

Query: 318 RYHNRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLSG*LRCAHRSCRYR*IRSWYL* 497
           RYH+RY  +EVR+ ++L  +H  + + RFHQEHDHR+ SG LR    S R+R        
Sbjct: 16  RYHDRYRVVEVRDGEILRDYHRRARSSRFHQEHDHRDESGGLRRVDSSGRHR-------- 67

Query: 498 ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVA 677
                EHALLAFTLGVKQLIVGVNKMD T+PPYSE RFEEIKKEVSSYIKKIGYN A+VA
Sbjct: 68  -----EHALLAFTLGVKQLIVGVNKMDMTDPPYSETRFEEIKKEVSSYIKKIGYNTASVA 122

Query: 678 FVPISGWHGDNMLEPS 725
           FVPISGWHGDNMLE S
Sbjct: 123 FVPISGWHGDNMLESS 138


>UniRef50_P50257 Cluster: Elongation factor 1-alpha S; n=1; Porphyra
           purpurea|Rep: Elongation factor 1-alpha S - Porphyra
           purpurea
          Length = 515

 Score =  172 bits (419), Expect = 7e-42
 Identities = 85/133 (63%), Positives = 98/133 (73%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHIN+VVIGHVD+GKSTTTGHLIYK GGID RTI KFE +A+E  K         
Sbjct: 1   MGKEKTHINLVVIGHVDAGKSTTTGHLIYKLGGIDARTIAKFEADAKEMGKSSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKF T+K+  T+IDAPGHRDFIKNMITGTSQAD A+L++    
Sbjct: 61  DKLKAERERGITIDIALWKFSTAKFEYTVIDAPGHRDFIKNMITGTSQADVALLVIDG-- 118

Query: 472 GEFEAGISKNGQT 510
             FEAGI++ G T
Sbjct: 119 NNFEAGIAEGGST 131



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 42/107 (39%), Positives = 55/107 (51%), Gaps = 30/107 (28%)
 Frame = +3

Query: 504 SNREHALLAFTLGVKQLIVGVNKMDSTEP----PYSEPRFEEIKKEVSSYIKKIGYNP-- 665
           S +EHALLA+TLGVKQL VG+NKMD  +     P+++ R+ E+   +   + KIG+    
Sbjct: 130 STKEHALLAYTLGVKQLAVGINKMDDVKDKDGGPWAQGRYNEVVDYLGPELMKIGFKKKD 189

Query: 666 ------------------------AAVAFVPISGWHGDNMLEPSTKM 734
                                    +  FVPISGW GDNMLE ST M
Sbjct: 190 KGDKKKGDKKEKKDKKDKGEKKYVCSATFVPISGWTGDNMLEKSTNM 236


>UniRef50_Q96TP0 Cluster: Elongation factor 1 alpha; n=5;
           Fungi/Metazoa group|Rep: Elongation factor 1 alpha -
           Gibberella intermedia (Bulb rot disease fungus)
           (Fusariumproliferatum)
          Length = 108

 Score =  164 bits (399), Expect = 2e-39
 Identities = 80/108 (74%), Positives = 86/108 (79%), Gaps = 1/108 (0%)
 Frame = +1

Query: 112 MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           MGKE KTH+N+VVIGHVDSGKSTTTGHLIY+CGGIDKRTIEKFEKEA E  K        
Sbjct: 1   MGKEDKTHLNVVVIGHVDSGKSTTTGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWV 60

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTS 432
               +     GITIDIALWKFET +YYVT+IDAPGHRDFIKNMITGTS
Sbjct: 61  LDKLKAERERGITIDIALWKFETPRYYVTVIDAPGHRDFIKNMITGTS 108


>UniRef50_P35021 Cluster: Elongation factor 1-alpha; n=53; cellular
           organisms|Rep: Elongation factor 1-alpha - Sulfolobus
           solfataricus
          Length = 435

 Score =  138 bits (334), Expect = 1e-31
 Identities = 63/130 (48%), Positives = 90/130 (69%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K H+N++VIGH+D GKST  G L+   G ID++T+++ E+ A++  K+           
Sbjct: 3   QKPHLNLIVIGHIDHGKSTLVGRLLMDRGFIDEKTVKEAEEAAKKLGKESEKFAFLLDRL 62

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
           +     G+TI++   +FET KY+ TIIDAPGHRDF+KNMITG SQAD A+L+V+A  GE+
Sbjct: 63  KEERERGVTINLTFMRFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILVVSAKKGEY 122

Query: 481 EAGISKNGQT 510
           EAG+S  GQT
Sbjct: 123 EAGMSVEGQT 132



 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 39/79 (49%), Positives = 51/79 (64%)
 Frame = +3

Query: 498 ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVA 677
           E   REH +LA T+G+ QLIV VNKMD TEPPY E R++EI  +VS +++  G+N   V 
Sbjct: 129 EGQTREHIILAKTMGLDQLIVAVNKMDLTEPPYDEKRYKEIVDQVSKFMRSYGFNTNKVR 188

Query: 678 FVPISGWHGDNMLEPSTKM 734
           FVP+    GDN+   S  M
Sbjct: 189 FVPVVAPAGDNITHRSENM 207


>UniRef50_Q9Y450 Cluster: HBS1-like protein; n=43; Euteleostomi|Rep:
           HBS1-like protein - Homo sapiens (Human)
          Length = 684

 Score =  130 bits (315), Expect = 3e-29
 Identities = 63/129 (48%), Positives = 86/129 (66%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++  K             
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G+T+D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFE
Sbjct: 318 EERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFE 377

Query: 484 AGISKNGQT 510
           AG    GQT
Sbjct: 378 AGFETGGQT 386



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH LL  +LGV QL V VNKMD     + + RF+EI  ++  ++K+ G+  + V F+P 
Sbjct: 387 REHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPT 444

Query: 690 SGWHGDNMLEPS 725
           SG  G+N++  S
Sbjct: 445 SGLSGENLITRS 456


>UniRef50_UPI0000499ED8 Cluster: guanine nucleotide regulatory
           protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep:
           guanine nucleotide regulatory protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 488

 Score =  130 bits (314), Expect = 3e-29
 Identities = 65/129 (50%), Positives = 86/129 (66%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K   NI+ IGHVD+GKSTT+G+++++ G I++R I+KFEKEA+E  ++   +        
Sbjct: 59  KESANIIFIGHVDAGKSTTSGNILFQSGNIEQRIIDKFEKEAKENQRESWWLAYIMDQIE 118

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              S GITID+    FET K   TI+DAPGHR F+ NMI+  +QAD AVLIV+A  GEFE
Sbjct: 119 EEKSKGITIDVGRALFETEKRRYTILDAPGHRSFVPNMISAAAQADIAVLIVSARKGEFE 178

Query: 484 AGISKNGQT 510
            G  K GQT
Sbjct: 179 TGFDKGGQT 187



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 25/68 (36%), Positives = 43/68 (63%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH+ L  T GVK +I+ VNKMD     + + R++EI  +V  ++++ G++   +  +PI
Sbjct: 188 REHSQLCRTAGVKTVIIAVNKMDEKTVGWEKSRYDEIVNKVKPFLRQCGFSD--IYSIPI 245

Query: 690 SGWHGDNM 713
           SG+ G N+
Sbjct: 246 SGFSGLNL 253


>UniRef50_P15170 Cluster: G1 to S phase transition protein 1
           homolog; n=77; Eukaryota|Rep: G1 to S phase transition
           protein 1 homolog - Homo sapiens (Human)
          Length = 499

 Score =  130 bits (314), Expect = 3e-29
 Identities = 62/135 (45%), Positives = 87/135 (64%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  ++   +  
Sbjct: 66  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 125

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                +     G T+++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A
Sbjct: 126 ALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISA 185

Query: 466 GTGEFEAGISKNGQT 510
             GEFE G  K GQT
Sbjct: 186 RKGEFETGFEKGGQT 200



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 35/73 (47%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REHA+LA T GVK LIV +NKMD     +S  R+EE K+++  ++KK+G+NP   + F+P
Sbjct: 201 REHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMP 260

Query: 687 ISGWHGDNMLEPS 725
            SG  G N+ E S
Sbjct: 261 CSGLTGANLKEQS 273


>UniRef50_Q96WS7 Cluster: Eukaryotic release factor 3; n=1;
           Pneumocystis carinii|Rep: Eukaryotic release factor 3 -
           Pneumocystis carinii
          Length = 629

 Score =  127 bits (307), Expect = 2e-28
 Identities = 59/129 (45%), Positives = 88/129 (68%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K H+N+V IGHVD+GKST  G+++Y  G +DKRT+EK+EK+A+E  ++   +     + +
Sbjct: 200 KEHVNVVFIGHVDAGKSTLGGNILYMTGMVDKRTMEKYEKDAKEAGRESWYLSWALDSTK 259

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              S G T+++    FET K   TI+DAPGH+ ++ NMI GT+QA+ AVL+++A  GE+E
Sbjct: 260 EERSKGKTVELGRAYFETEKRRYTILDAPGHKSYVPNMIEGTAQAEVAVLVISARKGEYE 319

Query: 484 AGISKNGQT 510
            G  K GQT
Sbjct: 320 TGFEKGGQT 328



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 30/72 (41%), Positives = 48/72 (66%), Gaps = 2/72 (2%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKK-IGYNPAA-VAFV 683
           REHA+L+ T GV +LIV +NKMD     +S+ R++E    ++++++K +GYNP     F+
Sbjct: 329 REHAMLSKTQGVSKLIVAINKMDDPTVEWSKERYDECTNGITTFLRKEVGYNPKTDFVFM 388

Query: 684 PISGWHGDNMLE 719
           PIS + G N+ E
Sbjct: 389 PISAFTGINIKE 400


>UniRef50_P90922 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 610

 Score =  127 bits (306), Expect = 3e-28
 Identities = 63/130 (48%), Positives = 81/130 (62%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K  IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA    K            
Sbjct: 185 DKDLINLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDET 244

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
                 G+T+DI    FETS   + ++DAPGH+DFI NMITGTSQAD A+L+V A TGEF
Sbjct: 245 EEERERGVTMDIGRTSFETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVVNATTGEF 304

Query: 481 EAGISKNGQT 510
           E G    GQT
Sbjct: 305 ETGFENGGQT 314



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 31/71 (43%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYI-KKIGYNPAAVAFVP 686
           +EHALL  +LGV QLIV VNK+D+ +  +S+ RF+EIK  +S ++ ++ G++     FVP
Sbjct: 315 KEHALLLRSLGVTQLIVAVNKLDTVD--WSQDRFDEIKNNLSVFLTRQAGFSKP--KFVP 370

Query: 687 ISGWHGDNMLE 719
           +SG+ G+N+++
Sbjct: 371 VSGFTGENLIK 381


>UniRef50_O45622 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 532

 Score =  127 bits (306), Expect = 3e-28
 Identities = 60/132 (45%), Positives = 85/132 (64%)
 Frame = +1

Query: 115 GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWT 294
           G  K HIN+V +GHVD+GKST  G L++  G +DKRT+EK+E+EA+E  ++   +     
Sbjct: 104 GTHKEHINMVFVGHVDAGKSTIGGQLMFLTGMVDKRTLEKYEREAKEKGRESWYLSWCMD 163

Query: 295 N*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                   G T+++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL+++A  G
Sbjct: 164 TNDEEREKGKTVEVGRAYFETEKRHFTILDAPGHKSFVPNMIVGANQADLAVLVISARRG 223

Query: 475 EFEAGISKNGQT 510
           EFE G  + GQT
Sbjct: 224 EFETGFDRGGQT 235



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 28/66 (42%), Positives = 45/66 (68%), Gaps = 1/66 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REH++L  T GVK L++ VNKMD     + E RF+EI+ +++ +++K+G+NP   + +VP
Sbjct: 236 REHSMLVKTAGVKHLVILVNKMDDPTVKWEEERFKEIEGKLTPFLRKLGFNPKTDITYVP 295

Query: 687 ISGWHG 704
            SG  G
Sbjct: 296 CSGLTG 301


>UniRef50_A6RVA8 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 756

 Score =  127 bits (306), Expect = 3e-28
 Identities = 66/131 (50%), Positives = 83/131 (63%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           K K   N VVIGHVD+GKST  G L+Y    +D+RT++++ KEA+   K    +      
Sbjct: 343 KSKNAANFVVIGHVDAGKSTLMGRLLYDLKVVDQRTVDRYRKEAEAMGKSSFALAWVLDQ 402

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
                S G+TIDIA+ KFET K   TI+DAPGHRDFI NMI G SQAD AVL++ A  G 
Sbjct: 403 GTEERSRGVTIDIAMNKFETEKTTFTILDAPGHRDFIPNMIAGASQADFAVLVIDASVGS 462

Query: 478 FEAGISKNGQT 510
           FE+G+   GQT
Sbjct: 463 FESGL--KGQT 471



 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 31/74 (41%), Positives = 53/74 (71%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EHALLA ++GV+++I+ VNK+D+    +S+ RF+EI ++VS+++   G+    + F+P 
Sbjct: 472 KEHALLARSMGVQRIIIAVNKLDTVG--WSQERFDEISQQVSAFLTAAGFQEQNIKFIPC 529

Query: 690 SGWHGDNMLEPSTK 731
           SG HGDN+   ST+
Sbjct: 530 SGLHGDNIARKSTE 543


>UniRef50_UPI0000D55B6A Cluster: PREDICTED: similar to CG1898-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1898-PA - Tribolium castaneum
          Length = 792

 Score =  124 bits (299), Expect = 2e-27
 Identities = 60/132 (45%), Positives = 85/132 (64%)
 Frame = +1

Query: 115 GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWT 294
           G  K H+ +VVIGHVD+GKST  GHL+Y  G ++++T+ K+E+E+++  K          
Sbjct: 363 GDSKEHLYMVVIGHVDAGKSTLMGHLLYDLGQVNQKTMHKYEQESRKVGKQSFMYAWVLD 422

Query: 295 N*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                 + GIT+D+   +FET   +VT++DAPGH+DFI NMI+G  QAD A+L+V A  G
Sbjct: 423 ETGEERNRGITMDVGRSQFETKSKHVTLLDAPGHKDFIPNMISGAGQADVALLVVDATRG 482

Query: 475 EFEAGISKNGQT 510
           EFE G    GQT
Sbjct: 483 EFETGFDFGGQT 494



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 30/74 (40%), Positives = 49/74 (66%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALL  +LGV QL V +NK+D+    +S+ RF++I +++  ++K+ G+    V FVP 
Sbjct: 495 REHALLVRSLGVTQLAVAINKLDTVS--WSKERFDDISQKLKVFLKQAGFREGDVTFVPC 552

Query: 690 SGWHGDNMLEPSTK 731
           SG  G N+++  T+
Sbjct: 553 SGLTGQNLVDKPTE 566


>UniRef50_O93729 Cluster: Elongation factor 1-alpha; n=20;
           Archaea|Rep: Elongation factor 1-alpha - Pyrobaculum
           aerophilum
          Length = 444

 Score =  124 bits (298), Expect = 3e-27
 Identities = 57/129 (44%), Positives = 84/129 (65%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K HIN+ V+GHVD+GKST  G L+Y+ G +D++ +++ E+ A++  K+           
Sbjct: 14  QKPHINLAVVGHVDNGKSTLVGRLLYETGYVDEKALKEIEEMAKKIGKEDFAFAWILDRF 73

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
           +     G+TI+     FET+K ++TIID PGHRDF+KNMI G SQAD A+ +++A  GEF
Sbjct: 74  KEERERGVTIEATHVGFETNKLFITIIDLPGHRDFVKNMIVGASQADAALFVISARPGEF 133

Query: 481 EAGISKNGQ 507
           EA I   GQ
Sbjct: 134 EAAIGPQGQ 142



 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 33/73 (45%), Positives = 49/73 (67%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH  L  TLGV+Q++V VNKMD     Y + R+E++K EVS  +K +GY+P+ + F+P+
Sbjct: 144 REHLFLIRTLGVQQIVVAVNKMDVVN--YDQKRYEQVKAEVSKLLKLLGYDPSKIHFIPV 201

Query: 690 SGWHGDNMLEPST 728
           S   GDN+   S+
Sbjct: 202 SAIKGDNIKTKSS 214


>UniRef50_A4ZCD1 Cluster: GTP-binding protein; n=9;
           Magnoliophyta|Rep: GTP-binding protein - Triticum
           aestivum (Wheat)
          Length = 533

 Score =  123 bits (296), Expect = 5e-27
 Identities = 58/131 (44%), Positives = 83/131 (63%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           +EK HIN+V IGHVD+GKST  G +++  G +D RTI+K+EKEA++  ++   M      
Sbjct: 88  EEKRHINLVFIGHVDAGKSTAGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDT 147

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
                  G T+++    FET     TI+DAPGH+ ++ NMI+G SQAD  VL+++A  GE
Sbjct: 148 NEEERLKGKTVEVGRAHFETENTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGE 207

Query: 478 FEAGISKNGQT 510
           FE G  + GQT
Sbjct: 208 FETGYERGGQT 218



 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 32/69 (46%), Positives = 46/69 (66%), Gaps = 1/69 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYN-PAAVAFVP 686
           REH LLA TLGV +L+V +NKMD     +S+ R++EI+ ++  +++  GYN    V F+P
Sbjct: 219 REHVLLAKTLGVAKLVVVINKMDEPTVQWSKERYDEIEGKMIPFLRSSGYNVKKDVQFLP 278

Query: 687 ISGWHGDNM 713
           ISG  G NM
Sbjct: 279 ISGLCGANM 287


>UniRef50_Q86NR4 Cluster: RE29053p; n=5; Diptera|Rep: RE29053p -
           Drosophila melanogaster (Fruit fly)
          Length = 670

 Score =  121 bits (292), Expect = 2e-26
 Identities = 58/130 (44%), Positives = 84/130 (64%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K+HI+++VIGHVD+GKST  GHL+Y  G + +R + K E+E+++  K            
Sbjct: 244 QKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDET 303

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
               + GIT+D+   + ET    VT++DAPGH+DFI NMI+G +QAD A+L+V A  GEF
Sbjct: 304 GEERARGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEF 363

Query: 481 EAGISKNGQT 510
           E+G    GQT
Sbjct: 364 ESGFELGGQT 373



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 29/68 (42%), Positives = 45/68 (66%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHA+L  +LGV QL V +NK+D+    +S+ RF EI  ++ S++K  G+  + V+F P 
Sbjct: 374 REHAILVRSLGVNQLGVVINKLDTVG--WSQDRFTEIVTKLKSFLKLAGFKDSDVSFTPC 431

Query: 690 SGWHGDNM 713
           SG  G+N+
Sbjct: 432 SGLTGENL 439


>UniRef50_A2AX44 Cluster: Translation elongation factor 1 like;
           n=37; Eukaryota|Rep: Translation elongation factor 1
           like - Guillardia theta (Cryptomonas phi)
          Length = 472

 Score =  121 bits (291), Expect = 2e-26
 Identities = 62/126 (49%), Positives = 82/126 (65%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           EK H++IV+ GHVDSGKSTTTG L+++ GGI +R +EK ++EA    K       Y    
Sbjct: 3   EKEHLSIVICGHVDSGKSTTTGRLLFELGGIPERELEKLKEEAANLGKSSFAFAFYMDRQ 62

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
           +     G+TI     +F T K++ TIIDAPGHRDFIKNMI+G++QAD A+L+V A  G F
Sbjct: 63  KEERERGVTIACTTKEFFTDKWHYTIIDAPGHRDFIKNMISGSAQADVALLMVPA-DGNF 121

Query: 481 EAGISK 498
              I K
Sbjct: 122 TTAIQK 127



 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 37/79 (46%), Positives = 52/79 (65%), Gaps = 4/79 (5%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYN----PAAVA 677
           R+HA +   LG+KQLIVG+NKMDS    Y E R+ EI+ E+ + + ++G+      A+V 
Sbjct: 140 RQHARILNLLGIKQLIVGINKMDSDTAGYKEERYNEIRDEMRNMLIRVGWKKEFVAASVP 199

Query: 678 FVPISGWHGDNMLEPSTKM 734
            +PISGW GDN+L  ST M
Sbjct: 200 VIPISGWMGDNLLTKSTNM 218


>UniRef50_Q8IIC9 Cluster: Translation elongation factor EF-1,
           subunit alpha, putative; n=11; Apicomplexa|Rep:
           Translation elongation factor EF-1, subunit alpha,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 555

 Score =  121 bits (291), Expect = 2e-26
 Identities = 58/129 (44%), Positives = 83/129 (64%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           + H+NI+ IGHVD+GKST  G+++Y  G +D RTIEK+E+EA+E  ++   +        
Sbjct: 117 RPHLNIIFIGHVDAGKSTACGNILYILGYVDDRTIEKYEREAKEKSRESWFLAFIMDINE 176

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G T+++    FET     TI+DAPGH++FI NMI+G +QAD  VLI++A  GEFE
Sbjct: 177 EERQKGKTVEVGRAHFETKDRRFTILDAPGHKNFIPNMISGAAQADIGVLIISARKGEFE 236

Query: 484 AGISKNGQT 510
            G  + GQT
Sbjct: 237 TGFERGGQT 245



 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYN-PAAVAFVP 686
           REH LLA TLG+ QLIV +NKMD     +SE R+EEI+K+++ YIK  GYN    V FVP
Sbjct: 246 REHTLLARTLGINQLIVAINKMDDPTCNWSESRYEEIQKKITPYIKSCGYNINKDVFFVP 305

Query: 687 ISGWHGDNMLE 719
           ISG  G N+ E
Sbjct: 306 ISGLTGQNLSE 316


>UniRef50_Q5UHI3 Cluster: EF-1 alpha-like protein; n=6;
           Eukaryota|Rep: EF-1 alpha-like protein - Bigelowiella
           natans (Pedinomonas minutissima) (Chlorarachnion
           sp.(strain CCMP 621))
          Length = 513

 Score =  120 bits (289), Expect = 4e-26
 Identities = 56/126 (44%), Positives = 82/126 (65%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K H+ +V++GHVD+GKSTTTGHL+++ G +D+R       +A+E  K+      +    
Sbjct: 18  DKPHLGVVIVGHVDAGKSTTTGHLLFELGTMDERAKADLIAKAKEMKKESFAFAFFMDKQ 77

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
           +     G+TI     +F T+ ++ T+IDAPGH+DFIKNMI+G SQAD A+L+V A  G F
Sbjct: 78  KEERERGVTISCTTKEFHTTNFHYTVIDAPGHKDFIKNMISGASQADVALLMVPAKKGGF 137

Query: 481 EAGISK 498
           EA I K
Sbjct: 138 EAAIQK 143



 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 38/92 (41%), Positives = 52/92 (56%), Gaps = 17/92 (18%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGY---------- 659
           R HA L   LG++Q+IVGVNKMD     Y + R++EIKK + S +K+ G+          
Sbjct: 156 RHHAELTKLLGIQQIIVGVNKMDEKSVKYDQARYKEIKKNMLSMLKQSGWKINGKLTKEL 215

Query: 660 -------NPAAVAFVPISGWHGDNMLEPSTKM 734
                   P  +  +PISGW GDN++ PSTKM
Sbjct: 216 KEAGKKKGPNLIPVIPISGWCGDNLIVPSTKM 247


>UniRef50_Q00WU5 Cluster: EF-1 alpha-like protein; n=1; Ostreococcus
           tauri|Rep: EF-1 alpha-like protein - Ostreococcus tauri
          Length = 444

 Score =  120 bits (289), Expect = 4e-26
 Identities = 62/129 (48%), Positives = 81/129 (62%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           M + K H++IV+ GHVDSGKSTTTG L+++ GGI +R +EK + EA    K       Y 
Sbjct: 8   MSEGKEHLSIVICGHVDSGKSTTTGRLLFELGGIPERELEKLKAEADALGKSSFAFAFYM 67

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     G+TI     +F T K++ TIIDAPGHRDFIKNMI+G +QAD A+L+V A  
Sbjct: 68  DRQKEERERGVTISCTTKEFFTEKWHYTIIDAPGHRDFIKNMISGAAQADVALLMVPA-D 126

Query: 472 GEFEAGISK 498
           G F   I K
Sbjct: 127 GNFTVAIQK 135



 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 4/79 (5%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIG----YNPAAVA 677
           R+HA L   LGVKQLI+G+NKMD     Y + R+EEI+ E+ + + K+G    Y   +V 
Sbjct: 148 RQHARLLNLLGVKQLIIGINKMDCDMAGYKQERYEEIRNEMKNMLIKVGWKKDYVEKSVP 207

Query: 678 FVPISGWHGDNMLEPSTKM 734
            +PISGW+GDN+L+ S KM
Sbjct: 208 VLPISGWNGDNLLKKSEKM 226


>UniRef50_A7D4X8 Cluster: Translation elongation factor EF-1,
           subunit alpha; n=1; Halorubrum lacusprofundi ATCC
           49239|Rep: Translation elongation factor EF-1, subunit
           alpha - Halorubrum lacusprofundi ATCC 49239
          Length = 540

 Score =  120 bits (288), Expect = 5e-26
 Identities = 58/118 (49%), Positives = 75/118 (63%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K H N+ +IGHVD GKST  G L+++ G + +  IE+  +EA+E  K          N 
Sbjct: 122 DKPHQNLAIIGHVDHGKSTLVGRLLFETGSVPEHVIEQHREEAEEKGKGGFEFAYVMDNL 181

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                 G+TIDIA  +F+T  YY TI+D PGHRDF+KNMITG SQAD AVL+VAA  G
Sbjct: 182 AEERERGVTIDIAHQEFDTDNYYFTIVDCPGHRDFVKNMITGASQADNAVLVVAADDG 239



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 29/72 (40%), Positives = 46/72 (63%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH  LA TLG+ ++I+GVNKMD  +  Y E  ++++ +EV+  + ++ +      FVPI
Sbjct: 245 REHVFLARTLGINEIIIGVNKMDLVD--YKESSYDQVVEEVNDLLNQVRFATDDTTFVPI 302

Query: 690 SGWHGDNMLEPS 725
           S + GDN+ E S
Sbjct: 303 SAFEGDNISEES 314


>UniRef50_Q9HGI4 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=2; Zygosaccharomyces rouxii|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Zygosaccharomyces rouxii (Candida mogii)
          Length = 662

 Score =  120 bits (288), Expect = 5e-26
 Identities = 56/129 (43%), Positives = 82/129 (63%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K H++I+ +GHVD+GKST  G+++Y  G +DKRT+EK+E+EA++  K    +       R
Sbjct: 235 KDHMSIIFMGHVDAGKSTMGGNILYMTGSVDKRTVEKYEREAKDAGKQGWYLSWVMDTNR 294

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G TI++    FET K   TI+DAPGH+ ++  MI G SQAD  +L+++A  GE+E
Sbjct: 295 EERDDGKTIEVGRAYFETEKRRYTILDAPGHKMYVSEMIGGASQADVGILVISARKGEYE 354

Query: 484 AGISKNGQT 510
            G  K GQT
Sbjct: 355 TGFEKGGQT 363



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 32/66 (48%), Positives = 46/66 (69%), Gaps = 1/66 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYN-PAAVAFVP 686
           REHALLA T GV +LIV +NKMD     +S+ R+++  K +S+++K IGYN    V F+P
Sbjct: 364 REHALLAKTQGVNKLIVTINKMDDPTVNWSKERYDQCVKNLSNFLKAIGYNVKEEVVFMP 423

Query: 687 ISGWHG 704
           +SG+ G
Sbjct: 424 VSGYSG 429


>UniRef50_O74718 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=2; Schizosaccharomyces pombe|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Schizosaccharomyces pombe (Fission yeast)
          Length = 662

 Score =  119 bits (287), Expect = 6e-26
 Identities = 57/129 (44%), Positives = 83/129 (64%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K H+NIV IGHVD+GKST  G++++  G +DKRT+EK E+EA+E  K+   +     +  
Sbjct: 236 KEHVNIVFIGHVDAGKSTLGGNILFLTGMVDKRTMEKIEREAKEAGKESWYLSWALDSTS 295

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G T+++    FET     +++DAPGH+ ++ NMI G SQAD  VL+++A  GEFE
Sbjct: 296 EEREKGKTVEVGRAYFETEHRRFSLLDAPGHKGYVTNMINGASQADIGVLVISARRGEFE 355

Query: 484 AGISKNGQT 510
           AG  + GQT
Sbjct: 356 AGFERGGQT 364



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 27/70 (38%), Positives = 46/70 (65%), Gaps = 2/70 (2%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKI-GYNPAA-VAFV 683
           REHA+LA T G+  L+V +NKMD     +SE R++E   ++S +++++ GYN    V ++
Sbjct: 365 REHAVLARTQGINHLVVVINKMDEPSVQWSEERYKECVDKLSMFLRRVAGYNSKTDVKYM 424

Query: 684 PISGWHGDNM 713
           P+S + G N+
Sbjct: 425 PVSAYTGQNV 434


>UniRef50_Q17263 Cluster: Elongation factor 1 alpha; n=4;
           Fungi/Metazoa group|Rep: Elongation factor 1 alpha -
           Brugia pahangi (Filarial nematode worm)
          Length = 123

 Score =  119 bits (286), Expect = 9e-26
 Identities = 55/69 (79%), Positives = 60/69 (86%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE + W K  S+M G W
Sbjct: 23  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKERKRWAKVHSSMHGCW 82

Query: 292 TN*RLSVSV 318
           T+ R +V+V
Sbjct: 83  TSWRRNVNV 91


>UniRef50_UPI0000DD78A4 Cluster: PREDICTED: similar to statin-like;
           n=1; Homo sapiens|Rep: PREDICTED: similar to statin-like
           - Homo sapiens
          Length = 254

 Score =  118 bits (285), Expect = 1e-25
 Identities = 54/73 (73%), Positives = 59/73 (80%)
 Frame = +3

Query: 513 EHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPIS 692
           EH LLA+TLG+KQLIV VNKMD TEPPYS   FEEI KEV +YIKKI YN   + FVPIS
Sbjct: 73  EHTLLAYTLGMKQLIVTVNKMDITEPPYSSTCFEEISKEVKAYIKKISYNSQTLPFVPIS 132

Query: 693 GWHGDNMLEPSTK 731
           GWHGDNMLEP +K
Sbjct: 133 GWHGDNMLEPGSK 145



 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/27 (74%), Positives = 22/27 (81%)
 Frame = +1

Query: 427 TSQADCAVLIVAAGTGEFEAGISKNGQ 507
           + Q DCAVLIVA+G GE EAGISKN Q
Sbjct: 44  SGQEDCAVLIVASGVGECEAGISKNKQ 70


>UniRef50_A6RA16 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 957

 Score =  118 bits (285), Expect = 1e-25
 Identities = 62/131 (47%), Positives = 82/131 (62%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           + K   N VVIGHVD+GKST  G L+Y+   +D+RTI++++KEA    K    +      
Sbjct: 419 ERKKAANFVVIGHVDAGKSTLMGRLLYELKAVDQRTIDRYQKEADRIGKGSFALAWVLDQ 478

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
                + G+TIDIA  +F T     TI+DAPGHRDF+ NMI G SQAD AVL++ A TG 
Sbjct: 479 GSEERARGVTIDIATNRFATENTNFTILDAPGHRDFVPNMIAGASQADFAVLVLDATTGN 538

Query: 478 FEAGISKNGQT 510
           FE+G+   GQT
Sbjct: 539 FESGL--RGQT 547



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 28/70 (40%), Positives = 49/70 (70%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EHALL  ++GV++++V VNKMD+    +S  RF+EI+++ +S++   G+    ++FVP 
Sbjct: 548 KEHALLVRSMGVQRIVVAVNKMDAAG--WSHDRFDEIQQQTASFLTTAGFQAKNISFVPC 605

Query: 690 SGWHGDNMLE 719
           SG  GDN+ +
Sbjct: 606 SGLRGDNVAQ 615


>UniRef50_O13354 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=31; cellular organisms|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Candida albicans (Yeast)
          Length = 715

 Score =  118 bits (284), Expect = 1e-25
 Identities = 54/129 (41%), Positives = 83/129 (64%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K H++I+ +GHVD+GKST  G+++Y  G +DKRT+EK+E+EA++  +    +       +
Sbjct: 290 KDHVSIIFMGHVDAGKSTMGGNILYLTGSVDKRTVEKYEREAKDAGRQGWYLSWVMDTNK 349

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              + G TI++    FET K   TI+DAPGH+ ++  MI G SQAD  +L+++A  GE+E
Sbjct: 350 EERNDGKTIEVGKAYFETDKRRYTILDAPGHKMYVSEMIGGASQADVGILVISARKGEYE 409

Query: 484 AGISKNGQT 510
            G  K GQT
Sbjct: 410 TGFEKGGQT 418



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 28/65 (43%), Positives = 45/65 (69%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLA T GV ++IV VNKMD +   +S+ R++E   ++ +++K IGY    + ++P+
Sbjct: 419 REHALLAKTQGVNKIIVVVNKMDDSTVGWSKERYQECTTKLGAFLKGIGYAKDDIIYMPV 478

Query: 690 SGWHG 704
           SG+ G
Sbjct: 479 SGYTG 483


>UniRef50_Q5KFJ4 Cluster: Translation release factor, putative; n=3;
           Eukaryota|Rep: Translation release factor, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 757

 Score =  118 bits (283), Expect = 2e-25
 Identities = 54/129 (41%), Positives = 86/129 (66%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K+H+NI+  GHVD+GKST  G L+Y  G +DKRT+EK+E+EA+   ++   +     + +
Sbjct: 313 KSHLNIIFTGHVDAGKSTMGGQLLYLTGAVDKRTMEKYEQEAKAAGRETWYLSWALDSGK 372

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              + G T+++    FE+ K   TI+DAPGH+ ++ +MI+G +QAD A+L+++A  GEFE
Sbjct: 373 EERAKGKTVEVGRAYFESEKRRYTILDAPGHKTYVPSMISGAAQADVALLVLSARKGEFE 432

Query: 484 AGISKNGQT 510
            G  + GQT
Sbjct: 433 TGFEREGQT 441



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 29/73 (39%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = +3

Query: 498 ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-V 674
           E   REHA+L    G+ +LIV VNKMD T   + + R++EI  +++ ++K +G+NP   +
Sbjct: 438 EGQTREHAMLIKNNGINKLIVVVNKMDDTTVQWDKGRYDEITTKITPFLKAVGFNPKTDI 497

Query: 675 AFVPISGWHGDNM 713
            F+P+S   G+NM
Sbjct: 498 TFIPVSAQIGENM 510


>UniRef50_A2QW82 Cluster: Contig An11c0160, complete genome; n=8;
           Eurotiomycetidae|Rep: Contig An11c0160, complete genome
           - Aspergillus niger
          Length = 809

 Score =  118 bits (283), Expect = 2e-25
 Identities = 61/131 (46%), Positives = 81/131 (61%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           + K  +N  VIGHVD+GKST  G L+     +D+RT+EK+ KEA++  K    +      
Sbjct: 397 QRKKAMNFAVIGHVDAGKSTLMGRLLADLKAVDQRTLEKYRKEAEKIGKGSFALAWVLDQ 456

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
                + G+TIDIA  KFET     TI+DAPGHRDF+ NMI G SQAD AVL++ +  G 
Sbjct: 457 GSEERARGVTIDIATNKFETESTVFTIVDAPGHRDFVPNMIAGASQADFAVLVIDSSIGN 516

Query: 478 FEAGISKNGQT 510
           FE+G+   GQT
Sbjct: 517 FESGL--KGQT 525



 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 33/72 (45%), Positives = 51/72 (70%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EHALL  ++GV+++I+ VNKMDS +  + + RFEEI+++VSS++   G+    +AFVP 
Sbjct: 526 KEHALLVRSMGVQRIIIAVNKMDSVQ--WDQGRFEEIEQQVSSFLTTAGFQAKNIAFVPC 583

Query: 690 SGWHGDNMLEPS 725
           SG  GDN+   S
Sbjct: 584 SGISGDNVTRRS 595


>UniRef50_P05453 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=50; Ascomycota|Rep: Eukaryotic
           peptide chain release factor GTP-binding subunit -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 685

 Score =  118 bits (283), Expect = 2e-25
 Identities = 55/129 (42%), Positives = 83/129 (64%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K H++++ +GHVD+GKST  G+L+Y  G +DKRTIEK+E+EA++  +    +       +
Sbjct: 258 KDHVSLIFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRQGWYLSWVMDTNK 317

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              + G TI++    FET K   TI+DAPGH+ ++  MI G SQAD  VL+++A  GE+E
Sbjct: 318 EERNDGKTIEVGKAYFETEKRRYTILDAPGHKMYVSEMIGGASQADVGVLVISARKGEYE 377

Query: 484 AGISKNGQT 510
            G  + GQT
Sbjct: 378 TGFERGGQT 386



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 31/69 (44%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYN-PAAVAFVP 686
           REHALLA T GV +++V VNKMD     +S+ R+++    VS++++ IGYN    V F+P
Sbjct: 387 REHALLAKTQGVNKMVVVVNKMDDPTVNWSKERYDQCVSNVSNFLRAIGYNIKTDVVFMP 446

Query: 687 ISGWHGDNM 713
           +SG+ G N+
Sbjct: 447 VSGYSGANL 455


>UniRef50_Q9NCN7 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Trichomonas vaginalis|Rep: Eukaryotic
           release factor 3 GTPase subunit - Trichomonas vaginalis
          Length = 587

 Score =  116 bits (279), Expect = 6e-25
 Identities = 57/129 (44%), Positives = 81/129 (62%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K H NIV IGHVD+GKST  GH++Y+ G +D+RTIE+++ E+ +  +            +
Sbjct: 160 KKHFNIVFIGHVDAGKSTLCGHVLYQAGCVDQRTIEQYQAESAKEGRGSWYFSWVMDLSK 219

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              S G T ++ +  FET++   TI+DAPGHR ++  MI G  QAD AVL+++A  GEFE
Sbjct: 220 EERSKGKTEEVGVAHFETAQNKYTILDAPGHRSYVPQMIGGAVQADVAVLVISARNGEFE 279

Query: 484 AGISKNGQT 510
           AG    GQT
Sbjct: 280 AGFENGGQT 288



 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 25/74 (33%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query: 513 EHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYI-KKIGYNPAAVAFVPI 689
           EH L+A T GV+++I+ VNKMD     +S+ RF++I  + + +I ++IG+      ++PI
Sbjct: 290 EHLLIARTAGVREIIIVVNKMDDPTVKWSKERFDQIVTKFTPFIEREIGFKKDQYTYIPI 349

Query: 690 SGWHGDNMLEPSTK 731
           +   G N+ + S +
Sbjct: 350 AALTGFNLKQRSNE 363


>UniRef50_A3LY56 Cluster: Predicted protein; n=2; Pichia|Rep:
           Predicted protein - Pichia stipitis (Yeast)
          Length = 581

 Score =  115 bits (276), Expect = 1e-24
 Identities = 59/129 (45%), Positives = 78/129 (60%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K H + VVIGHVD+GKST  G +++  G +D RT+ +  KEA+   K    +        
Sbjct: 145 KPHKSFVVIGHVDAGKSTLMGRILFDYGIVDARTVNRLVKEAENAGKGSFALAWIMDQTA 204

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              S G+T+DI    FET     T IDAPGH+DF+  MI G SQAD A+L+V + TGEFE
Sbjct: 205 EERSHGVTVDICATDFETPTTRFTAIDAPGHKDFVPQMIGGVSQADLALLVVDSITGEFE 264

Query: 484 AGISKNGQT 510
           AG + +GQT
Sbjct: 265 AGFAMDGQT 273



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 44/175 (25%), Positives = 80/175 (45%), Gaps = 2/175 (1%)
 Frame = +3

Query: 216 QTYHREVREGGPGMGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHH*CSWT 395
           +T +R V+E     GKGSF  AW++D+   ER        C+ +                
Sbjct: 177 RTVNRLVKEA-ENAGKGSFALAWIMDQTAEERSHGVTVDICATDFETPTTRFTAIDAPGH 235

Query: 396 QRFHQEHDHRNLSG*LRCAHRSCRYR*IRSWYL*ERSNREHALLAFTLGVKQLIVGVNKM 575
           + F  +         L             + +  +   +EH +LA  LG++++ V VNK+
Sbjct: 236 KDFVPQMIGGVSQADLALLVVDSITGEFEAGFAMDGQTKEHTILAKNLGIERICVAVNKL 295

Query: 576 DSTEPPYSEPRFEEIKKEVSSYI--KKIGYNPAAVAFVPISGWHGDNMLEPSTKM 734
           D  +  ++E RFE IK +++ Y+   ++ +    + FVPISG  G+N+++  T +
Sbjct: 296 DKED--WNEERFESIKTQLTEYLTSDEVQFAEEQIDFVPISGLSGNNVVKRDTSI 348


>UniRef50_Q0U4R2 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 654

 Score =  114 bits (275), Expect = 2e-24
 Identities = 60/125 (48%), Positives = 78/125 (62%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N VV+GHVD GKST  G L+Y    +D+R+++K  KEA+   K    +           S
Sbjct: 245 NFVVVGHVDHGKSTLMGRLLYDLKVVDQRSLDKLRKEAETIGKSSFALAWIMDETSEERS 304

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 495
            G+T+DIA   FET K   TI+DAPGH+DFI NMI+G+SQAD  VL++ A T  FEAG+ 
Sbjct: 305 RGVTVDIATNYFETEKTRFTILDAPGHKDFIPNMISGSSQADFPVLVIDASTNSFEAGL- 363

Query: 496 KNGQT 510
             GQT
Sbjct: 364 -KGQT 367



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 23/70 (32%), Positives = 48/70 (68%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EH L+A ++G++ +IV VNKMD+    +S+PRF++I K +  ++ +  +    + F+P+
Sbjct: 368 KEHILIARSMGMQHIIVAVNKMDTVS--WSKPRFDDISKRMKVFLTEASFPEKRITFIPL 425

Query: 690 SGWHGDNMLE 719
           +G  G+N+++
Sbjct: 426 AGLTGENVVK 435


>UniRef50_Q2U0M0 Cluster: Translation elongation factor EF-1
           alpha/Tu; n=1; Aspergillus oryzae|Rep: Translation
           elongation factor EF-1 alpha/Tu - Aspergillus oryzae
          Length = 534

 Score =  114 bits (274), Expect = 2e-24
 Identities = 66/150 (44%), Positives = 84/150 (56%), Gaps = 19/150 (12%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKF-----------------EKE 246
           +EK HI  V +GH+D GKSTT   LIY+ G +    I ++                    
Sbjct: 95  REKPHITAVFLGHLDHGKSTTADQLIYQYGRVSGNPIAEYGSMLSLSSDLLCAGARPHDN 154

Query: 247 AQEWVKDPSNMLGYWTN*RLSVSV--GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMI 420
                  PS   G W   +L      GITIDI+L  FET K+ VT+IDAPGHRD+IKN I
Sbjct: 155 HSPQEAGPSYKYG-WVIEKLRAERKRGITIDISLCTFETPKFVVTVIDAPGHRDYIKNTI 213

Query: 421 TGTSQADCAVLIVAAGTGEFEAGISKNGQT 510
           TG SQADCA+L+ +A  GEFEAG+ + GQ+
Sbjct: 214 TGASQADCAILVTSATNGEFEAGVDQGGQS 243



 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 47/76 (61%), Positives = 59/76 (77%)
 Frame = +3

Query: 507 NREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVP 686
           +R+H +LA+TLGV+QLIV VNKMD+  P Y++    EI KE S +IKKIGYNP AVAFVP
Sbjct: 243 SRQHLVLAYTLGVRQLIVAVNKMDT--PRYTDDCLNEIVKETSDFIKKIGYNPKAVAFVP 300

Query: 687 ISGWHGDNMLEPSTKM 734
           ISG +GDN++E S  M
Sbjct: 301 ISGLYGDNLVEESQNM 316


>UniRef50_A7RM15 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 473

 Score =  112 bits (270), Expect = 7e-24
 Identities = 62/147 (42%), Positives = 84/147 (57%), Gaps = 13/147 (8%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFE----------KEAQEW 258
           K  + K  +N+V+IGHVD+GKST  GHL++  G + K+ + K+           K   E 
Sbjct: 31  KRHQGKELLNLVIIGHVDAGKSTLMGHLLFLLGDVSKKAMHKYPFFFLIIIFNLKACTES 90

Query: 259 VKDPSNMLGY-WTN*RLSVSV--GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGT 429
            K       Y W           GIT+D+ L +F+T    +T++DAPGH+DFI NMITG 
Sbjct: 91  KKAGKASFAYAWVLDETGEERERGITMDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGA 150

Query: 430 SQADCAVLIVAAGTGEFEAGISKNGQT 510
           +QAD A+L+V A TGEFEAG    GQT
Sbjct: 151 AQADVAILVVDAITGEFEAGFESGGQT 177



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 30/74 (40%), Positives = 51/74 (68%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHA+L  +LGV QLIV +NK+D     +SE R+  I  ++  ++K++G+  + V +VP+
Sbjct: 178 REHAILVRSLGVTQLIVAINKLDMMS--WSEERYLHIVSKLKHFLKQVGFKDSDVVYVPV 235

Query: 690 SGWHGDNMLEPSTK 731
           SG  G+N+++P T+
Sbjct: 236 SGLSGENLVKPCTE 249



 Score = 33.5 bits (73), Expect = 5.5
 Identities = 14/20 (70%), Positives = 15/20 (75%)
 Frame = +3

Query: 258 GKGSFKYAWVLDKLKAERER 317
           GK SF YAWVLD+   ERER
Sbjct: 94  GKASFAYAWVLDETGEERER 113


>UniRef50_Q759Q2 Cluster: ADR221Cp; n=3; Saccharomycetales|Rep:
           ADR221Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 614

 Score =  112 bits (269), Expect = 1e-23
 Identities = 51/131 (38%), Positives = 82/131 (62%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           ++K H++ VV+GHVD+GKST  G L+Y  G +D + I + ++E++   K   ++      
Sbjct: 173 EKKPHMSFVVLGHVDAGKSTLMGRLLYDVGAVDTKLIRQLKRESELAGKGSFHLAWVMDQ 232

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
                + G+T+DI   +FET+K   T+IDAPGHRDF+ N +TG + AD A++ +   T  
Sbjct: 233 TNEERARGVTVDICTSEFETAKSTFTVIDAPGHRDFVPNAVTGVNLADVAIVTIDCATDA 292

Query: 478 FEAGISKNGQT 510
           FE+G + +GQT
Sbjct: 293 FESGFNLDGQT 303



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 48/165 (29%), Positives = 79/165 (47%), Gaps = 1/165 (0%)
 Frame = +3

Query: 228 REVREGGPGMGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHH*CSWTQRFH 407
           R+++      GKGSF  AWV+D+   ER R      C+ E    +           + F 
Sbjct: 210 RQLKRESELAGKGSFHLAWVMDQTNEERARGVTVDICTSEFETAKSTFTVIDAPGHRDFV 269

Query: 408 QEH-DHRNLSG*LRCAHRSCRYR*IRSWYL*ERSNREHALLAFTLGVKQLIVGVNKMDST 584
                  NL+  +      C      S +  +   REH +LA +LGVK +I+ +NKMD+ 
Sbjct: 270 PNAVTGVNLAD-VAIVTIDCATDAFESGFNLDGQTREHIILARSLGVKHIILAMNKMDTV 328

Query: 585 EPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLE 719
           E  + E RF+ I+ E+ S+++ IG+     ++VP SG  G+ + +
Sbjct: 329 E--WHEGRFKAIRLELLSFLEDIGFKEPQTSWVPCSGLTGEGVYQ 371


>UniRef50_UPI0000E47BF2 Cluster: PREDICTED: similar to elongation
           factor 1 alpha; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to elongation factor 1 alpha -
           Strongylocentrotus purpuratus
          Length = 570

 Score =  111 bits (268), Expect = 1e-23
 Identities = 52/73 (71%), Positives = 61/73 (83%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALL +TLGVKQLIV VNKMDS +  Y+E RF+EI +EVS YIKK+GYNP AV F+PI
Sbjct: 359 REHALLCYTLGVKQLIVAVNKMDSAQ--YNEARFKEIVREVSGYIKKVGYNPKAVPFIPI 416

Query: 690 SGWHGDNMLEPST 728
           SGW GDNM+E +T
Sbjct: 417 SGWVGDNMMEAAT 429



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 22/26 (84%), Positives = 25/26 (96%)
 Frame = +1

Query: 433 QADCAVLIVAAGTGEFEAGISKNGQT 510
           +ADCAVL+VAAG GEFEAGISK+GQT
Sbjct: 333 KADCAVLVVAAGIGEFEAGISKDGQT 358


>UniRef50_Q6BVD7 Cluster: Similar to sp|P32769 Saccharomyces
           cerevisiae YKR084c HBS1; n=5; Saccharomycetales|Rep:
           Similar to sp|P32769 Saccharomyces cerevisiae YKR084c
           HBS1 - Debaryomyces hansenii (Yeast) (Torulaspora
           hansenii)
          Length = 600

 Score =  111 bits (268), Expect = 1e-23
 Identities = 55/129 (42%), Positives = 79/129 (61%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K H + VVIGHVD+GKST  G L++  G ID +T+    +++++  K    +        
Sbjct: 164 KPHKSFVVIGHVDAGKSTLMGRLLFDLGVIDAKTVNNLVRQSEKIGKGSFALAWIMDQTS 223

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              S G+T+DI    FET     T IDAPGH+DF+  MI+G SQAD A+L++ + TGEFE
Sbjct: 224 EERSRGVTVDICATNFETETSRFTAIDAPGHKDFVPQMISGVSQADFALLVIDSITGEFE 283

Query: 484 AGISKNGQT 510
           +G + +GQT
Sbjct: 284 SGFTMDGQT 292



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 48/164 (29%), Positives = 81/164 (49%), Gaps = 6/164 (3%)
 Frame = +3

Query: 255 MGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLS 434
           +GKGSF  AW++D+   ER R      C+      +   +    +     H++   + +S
Sbjct: 208 IGKGSFALAWIMDQTSEERSRGVTVDICATNFET-ETSRF---TAIDAPGHKDFVPQMIS 263

Query: 435 G*LRCAHRSCRYR*I----RSWYL*ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSE 602
           G  +          I     S +  +   +EH +LA  LG+ +L V VNKMD     +SE
Sbjct: 264 GVSQADFALLVIDSITGEFESGFTMDGQTKEHTILAKNLGIARLCVVVNKMDKEN--WSE 321

Query: 603 PRFEEIKKEVSSYI--KKIGYNPAAVAFVPISGWHGDNMLEPST 728
            RFE+IK +++ ++    IG++   + FVPISG  G+N+++  T
Sbjct: 322 RRFEDIKFQMTEFLTGSDIGFSSDQIDFVPISGLTGNNVVKTDT 365


>UniRef50_Q4QGW5 Cluster: Eukaryotic release factor 3, putative;
           n=8; Trypanosomatidae|Rep: Eukaryotic release factor 3,
           putative - Leishmania major
          Length = 763

 Score =  111 bits (267), Expect = 2e-23
 Identities = 56/129 (43%), Positives = 79/129 (61%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           + H NIV  GHVD+GKST +GHL+ + G +D+R +EK  +EA+   ++            
Sbjct: 324 RPHFNIVFCGHVDAGKSTISGHLLMEKGLVDQREMEKLRREAEINHREGWEYAYVMDVSE 383

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              S GIT +     FET K  VT++DAPGH+ F+ +MI G +QAD  VL++++ TGEFE
Sbjct: 384 EERSKGITRETGAAYFETEKRRVTVLDAPGHKAFVPSMIGGATQADICVLVISSRTGEFE 443

Query: 484 AGISKNGQT 510
            G  K GQT
Sbjct: 444 TGFEKGGQT 452



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 27/73 (36%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA---VAF 680
           REHA+L  T GVKQ+I  +NKMD  E  +S+ R+ EI   +  ++++ GY+      + F
Sbjct: 453 REHAMLVRTCGVKQMICVINKMD--EMKWSKERYSEIVGRLKPFLRQNGYDEERAKNLIF 510

Query: 681 VPISGWHGDNMLE 719
           +P++G  G+N+++
Sbjct: 511 MPVAGLTGENLIK 523


>UniRef50_Q9NCN8 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Giardia intestinalis|Rep: Eukaryotic
           release factor 3 GTPase subunit - Giardia lamblia
           (Giardia intestinalis)
          Length = 465

 Score =  111 bits (266), Expect = 2e-23
 Identities = 55/132 (41%), Positives = 83/132 (62%), Gaps = 1/132 (0%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           +++ ++NIV IGHVD+GKST +GHL+   G +DKR +EK E++A+   ++          
Sbjct: 12  EKRKNLNIVFIGHVDAGKSTISGHLVSDLGKLDKRQLEKLEQQAKALNRESWKYAFAMDT 71

Query: 298 *RLSVSVGITIDIALWKFETSK-YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                  G T++ A   F T     +TIIDAPGH+ F+ NMI+G +QAD A+L+++A  G
Sbjct: 72  SEEEREKGKTVECARESFLTPNGRRITIIDAPGHKGFVHNMISGAAQADTAILVISARKG 131

Query: 475 EFEAGISKNGQT 510
           EFE+G  + GQT
Sbjct: 132 EFESGFERGGQT 143



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 29/73 (39%), Positives = 48/73 (65%)
 Frame = +3

Query: 513 EHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPIS 692
           EHALLA+  G+KQ++  +NKMD     Y + R++ I  ++  Y++ +GY    + F+PIS
Sbjct: 145 EHALLAYVNGIKQIVCLINKMDDITVEYCKKRYDSIVSQLKLYLENVGYASKNIFFLPIS 204

Query: 693 GWHGDNMLEPSTK 731
           G+ G+N++  STK
Sbjct: 205 GFTGENLI--STK 215


>UniRef50_UPI000150A7E9 Cluster: Elongation factor Tu C-terminal
           domain containing protein; n=2; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 646

 Score =  110 bits (265), Expect = 3e-23
 Identities = 58/135 (42%), Positives = 86/135 (63%), Gaps = 1/135 (0%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           K+ +E+  +NIV IGHVD+GKST +G ++  CG +D+  I KFE EA+E  ++ S +L Y
Sbjct: 214 KVDRERDSVNIVFIGHVDAGKSTLSGRILKNCGEVDETEIRKFELEAKEKNRE-SWVLAY 272

Query: 289 WTN*RLSV-SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
             +      S GIT++     F+ +     ++DAPGH++++ NMI G  QAD A LI++A
Sbjct: 273 IMDINEEERSKGITVECGKAHFQLANKRFVLLDAPGHKNYVPNMIAGACQADVAALIISA 332

Query: 466 GTGEFEAGISKNGQT 510
             GEFEAG  + GQT
Sbjct: 333 RQGEFEAGF-EGGQT 346



 Score = 40.3 bits (90), Expect = 0.048
 Identities = 24/72 (33%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIK-KIGYNPAAVAFVP 686
           +EHA LA  LGV+ +I  V+KMD  E  + + R++ I   V  +++ ++G    ++ +VP
Sbjct: 347 QEHAHLAKALGVQHMICVVSKMD--EVNWDKKRYDHIHDSVEPFLRNQVGIQ--SIEWVP 402

Query: 687 ISGWHGDNMLEP 722
           I+G+  +N+  P
Sbjct: 403 INGFLNENIDTP 414


>UniRef50_A4R2K6 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 630

 Score =  110 bits (265), Expect = 3e-23
 Identities = 57/130 (43%), Positives = 80/130 (61%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K + + VV+GHVD+GKST  G L+     +D RTI K++KEA+   K    +     + 
Sbjct: 276 KKKNASFVVVGHVDAGKSTMMGRLLLDMNVVDDRTISKYKKEAEAMGKGSFALAWVLDST 335

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
               + G+TIDIA  +FET     TI+DAPGH+DF+ NMI G SQAD A+L++ A  G +
Sbjct: 336 SDERAHGVTIDIAKSRFETESTIFTILDAPGHQDFVPNMIAGASQADFAILVIDATVGAY 395

Query: 481 EAGISKNGQT 510
           E G+   GQT
Sbjct: 396 ERGL--KGQT 403



 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 30/73 (41%), Positives = 51/73 (69%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EHA L  ++GV ++IV VNK+D+T   +S+ RF EI   +S ++  +G+    ++F+P+
Sbjct: 404 KEHAQLIRSIGVSRIIVAVNKLDATN--WSQDRFNEISDGMSGFMSALGFQMKNISFIPL 461

Query: 690 SGWHGDNMLEPST 728
           SG +GDNM++ ST
Sbjct: 462 SGLNGDNMVKRST 474


>UniRef50_Q8SS29 Cluster: TRANSLATION ELONGATION FACTOR 1 ALPHA;
           n=2; Apansporoblastina|Rep: TRANSLATION ELONGATION
           FACTOR 1 ALPHA - Encephalitozoon cuniculi
          Length = 505

 Score =  109 bits (262), Expect = 7e-23
 Identities = 60/124 (48%), Positives = 76/124 (61%), Gaps = 1/124 (0%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  +N   IGHVDSGKSTT G L Y+ G +DKR +EK+EKEA    K+ +  L Y T+  
Sbjct: 44  KPRLNACFIGHVDSGKSTTVGMLSYQLGAVDKREMEKYEKEAALNNKE-TFYLAYLTDKT 102

Query: 304 -LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
                 GITI   L    T K+ + I+D PGH+DF+KNM+TG SQAD AV+IV A   E 
Sbjct: 103 DAERKRGITITTTLVNLPTEKFNINILDCPGHKDFVKNMVTGASQADVAVVIVPASGFES 162

Query: 481 EAGI 492
             G+
Sbjct: 163 CVGV 166



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 21/74 (28%), Positives = 37/74 (50%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           + H +++  LG ++LIV VNKMD         +F E+  E+   +K+  +       +PI
Sbjct: 171 KTHIMISGILGCEKLIVCVNKMDEIPENKRMEKFNEVSAEMLRIVKR-SHKDKNPIIIPI 229

Query: 690 SGWHGDNMLEPSTK 731
           S + G N+ +   K
Sbjct: 230 SAFKGINLTKKGEK 243


>UniRef50_Q6JIY6 Cluster: Translation elongation factor 1 alpha;
           n=3; Microsporidia|Rep: Translation elongation factor 1
           alpha - Antonospora locustae (Nosema locustae)
          Length = 478

 Score =  108 bits (260), Expect = 1e-22
 Identities = 57/128 (44%), Positives = 77/128 (60%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           M  +K ++N+ +IGHVDSGKSTT G+L Y+ G  D+R + K + EA    K       ++
Sbjct: 1   MEGKKPNLNVCIIGHVDSGKSTTMGNLAYQLGVFDQRQLTKLKAEADSHGKGTFAYAYFF 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
            N       GITIDI L +F+  K+   IID PGH+DFIKN +TG +QAD AV +V A  
Sbjct: 61  DNTAAERKRGITIDITLKEFKLKKFNANIIDCPGHKDFIKNTVTGAAQADVAVALVPA-- 118

Query: 472 GEFEAGIS 495
            +F A  S
Sbjct: 119 SDFAAATS 126



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/74 (32%), Positives = 44/74 (59%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           ++H +++  +G+K+LI+ VNKMD   P   + +FE IKKE+    +++  +   +  +PI
Sbjct: 132 KDHIMISGVMGIKRLIICVNKMDEFPPEKQKEKFEWIKKEMLFISQRLHPDKDPI-IIPI 190

Query: 690 SGWHGDNMLEPSTK 731
           SG  G N+ +   K
Sbjct: 191 SGLKGINIADHGEK 204


>UniRef50_Q7YZN9 Cluster: Eukaryotic release factor 3; n=2;
           Dictyostelium discoideum|Rep: Eukaryotic release factor
           3 - Dictyostelium discoideum (Slime mold)
          Length = 557

 Score =  108 bits (259), Expect = 2e-22
 Identities = 52/130 (40%), Positives = 83/130 (63%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           + H+NIV +GHVD+GKST +G ++   G +D  T+ K+E+EA+E  ++            
Sbjct: 115 REHLNIVFLGHVDAGKSTLSGSIMVLTGQVDPHTLAKYEREAKENHREGWIYAYIMDTNE 174

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              + G T+++    FET+K   TI+DAPGHR ++ NMI G +QAD  +L++++  GEFE
Sbjct: 175 EERTKGKTVEVGRAHFETTKKRYTILDAPGHRLYVPNMIIGAAQADVGILVISSKKGEFE 234

Query: 484 AGISKNGQTV 513
           AG+ + GQT+
Sbjct: 235 AGV-EGGQTI 243



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 31/71 (43%), Positives = 46/71 (64%), Gaps = 1/71 (1%)
 Frame = +3

Query: 513 EHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVPI 689
           EHA LA  +G+K L+V VNKMD     +S+ R++EI  +++ ++KK G+NP     FVP 
Sbjct: 244 EHARLAKMIGIKYLVVFVNKMDEPTVKWSKARYDEITDKLTVHLKKCGWNPKKDFHFVPG 303

Query: 690 SGWHGDNMLEP 722
           SG+   N+L P
Sbjct: 304 SGYGTLNVLAP 314


>UniRef50_Q7YZN7 Cluster: Hsp70 subfamily B suppressor 1; n=3;
           Dictyostelium discoideum|Rep: Hsp70 subfamily B
           suppressor 1 - Dictyostelium discoideum (Slime mold)
          Length = 317

 Score =  107 bits (258), Expect = 2e-22
 Identities = 53/114 (46%), Positives = 72/114 (63%)
 Frame = +1

Query: 169 KSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGITIDIALWK 348
           KSTT GH+++K G +DKRT+ KFE E+    K   +              G+T+D+ +  
Sbjct: 1   KSTTMGHILFKLGYVDKRTMSKFENESNRMGKSSFHFAWVLDEQEEERERGVTMDVCVRY 60

Query: 349 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 510
           FET    +T++DAPGHRDFI NMI+GT+QAD A+L++ A   EFEAG S  GQT
Sbjct: 61  FETEHRRITLLDAPGHRDFIPNMISGTTQADVAILLINA--SEFEAGFSAEGQT 112



 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 50/157 (31%), Positives = 82/157 (52%), Gaps = 2/157 (1%)
 Frame = +3

Query: 255 MGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLS 434
           MGK SF +AWVLD+ + ERER      C   VR  +   +          H++     +S
Sbjct: 30  MGKSSFHFAWVLDEQEEERERGVTMDVC---VRYFETE-HRRITLLDAPGHRDFIPNMIS 85

Query: 435 G*LRC--AHRSCRYR*IRSWYL*ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPR 608
           G  +   A          + +  E   +EHALLA +LG+ +LIV VNKMDS E  + + R
Sbjct: 86  GTTQADVAILLINASEFEAGFSAEGQTKEHALLAKSLGIMELIVAVNKMDSIE--WDQSR 143

Query: 609 FEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLE 719
           ++ I + + +++    +N   + F+PISG+ G+N+++
Sbjct: 144 YDYIVETIKTFLVHAKFNEKNIRFIPISGFTGENLID 180


>UniRef50_Q2GS47 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 840

 Score =  106 bits (254), Expect = 6e-22
 Identities = 58/131 (44%), Positives = 78/131 (59%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           K K   + VV+GHVD+GKST  G L+     +D+RTI+K +KEA+   K    +      
Sbjct: 429 KPKKSASFVVVGHVDAGKSTMMGRLLLDLKVVDQRTIDKLQKEAKTEGKGSFGLAWVLDQ 488

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
                S GIT+DIA  +FET     TI+DAPGH ++I NMI G SQAD A+L++ A    
Sbjct: 489 RPEERSRGITMDIATRRFETEHTAFTILDAPGHAEYIYNMIAGASQADFAILVIDASIDA 548

Query: 478 FEAGISKNGQT 510
           FE+G+   GQT
Sbjct: 549 FESGL--KGQT 557



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 30/72 (41%), Positives = 49/72 (68%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH+LL  ++GV ++IV VNK+D+    +S+ RF EIK ++S ++    +    +AFVP+
Sbjct: 558 REHSLLIRSMGVSRIIVAVNKLDTVA--WSQERFSEIKDQMSGFLSTANFQHKNMAFVPV 615

Query: 690 SGWHGDNMLEPS 725
           SG +GDN++  S
Sbjct: 616 SGLNGDNLVHRS 627


>UniRef50_Q9NCN5 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Euplotes|Rep: Eukaryotic release factor 3
           GTPase subunit - Euplotes aediculatus
          Length = 805

 Score =  105 bits (253), Expect = 9e-22
 Identities = 55/126 (43%), Positives = 82/126 (65%), Gaps = 1/126 (0%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV- 312
           ++V IGHVD+GKST  G+L++  G +D+RT EKF++EA+E  +D S  L Y  +      
Sbjct: 311 SLVFIGHVDAGKSTICGNLMFMTGMVDERTTEKFKQEAKEKNRD-SWWLAYVMDINDDEK 369

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 492
           S G T+++     ET     TI DAPGH++++ +MI G + AD A L+++A  GEFEAG 
Sbjct: 370 SKGKTVEVGRATMETPTKRYTIFDAPGHKNYVPDMIMGAAMADVAALVISARKGEFEAGF 429

Query: 493 SKNGQT 510
            ++GQT
Sbjct: 430 ERDGQT 435



 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSY-IKKIGYNPAAVAFVP 686
           REHA LA +LGV +L+V VNKMD     ++E R+ +I   V+ + I++ GY    + F+P
Sbjct: 436 REHAQLARSLGVSKLVVVVNKMDEETVQWNEARYNDIVSGVTPFLIEQCGYKREDLIFIP 495

Query: 687 ISGWHGDNM 713
           ISG +G N+
Sbjct: 496 ISGLNGQNI 504


>UniRef50_A2FN77 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Trichomonas vaginalis G3|Rep:
           Elongation factor Tu C-terminal domain containing
           protein - Trichomonas vaginalis G3
          Length = 607

 Score =  105 bits (253), Expect = 9e-22
 Identities = 48/122 (39%), Positives = 73/122 (59%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K H+N+V++GHVD+GKST  GH++     ++K+ ++K  ++++        +        
Sbjct: 188 KKHVNLVIVGHVDAGKSTLIGHVLLLSNFVEKQRMDKIMEDSKATGHGQDYLAWIMAEDE 247

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              S G+TID+AL  FET    +T++DAPGHRDF+ NMI G SQAD A+L+V       E
Sbjct: 248 SERSHGVTIDVALNNFETEDRKITVLDAPGHRDFVPNMIAGASQADSAILVVDVSNPNIE 307

Query: 484 AG 489
            G
Sbjct: 308 RG 309



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 29/74 (39%), Positives = 44/74 (59%)
 Frame = +3

Query: 513 EHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPIS 692
           EH LL  +LGVK LIV +NKMDS E  Y +  +E++   ++ ++K+I +  +AV F+P  
Sbjct: 313 EHILLCRSLGVKHLIVAINKMDSLE--YMQSAYEDVCNTLTEHLKRISW--SAVHFIPTV 368

Query: 693 GWHGDNMLEPSTKM 734
                 +L P  KM
Sbjct: 369 ATDKSVLLNPKEKM 382


>UniRef50_Q9NCN6 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=1; Sterkiella histriomuscorum|Rep: Eukaryotic
           release factor 3 GTPase subunit - Oxytricha trifallax
           (Sterkiella histriomuscorum)
          Length = 937

 Score =  105 bits (252), Expect = 1e-21
 Identities = 54/130 (41%), Positives = 81/130 (62%), Gaps = 5/130 (3%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           ++V IGHVD+GKST +G+L+Y  G +D+RTI+K+++EA+E      N   +W    + VS
Sbjct: 421 SLVFIGHVDAGKSTISGNLMYLMGAVDQRTIQKYKEEAKE-----KNRESWWLAYVMDVS 475

Query: 316 V-----GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
                 G T+++     ET K   TI DAPGH++++ NMI G + AD   L+++A  GEF
Sbjct: 476 EEEKAKGKTVEVGRANIETPKKRWTIFDAPGHKNYVPNMIMGAALADFGALVISAKKGEF 535

Query: 481 EAGISKNGQT 510
           E+G    GQT
Sbjct: 536 ESGFEMEGQT 545



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 32/79 (40%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +3

Query: 498 ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-V 674
           E   REH  LA +LG+ +++V VNKMD     +S+ R+ EI   +  +++  GY+P   +
Sbjct: 542 EGQTREHIQLAKSLGISKIVVAVNKMDEPSVKWSKDRYTEIINGLKPFMQGCGYDPEKDI 601

Query: 675 AFVPISGWHGDNMLEPSTK 731
            FVPISG +GDN+ +P  K
Sbjct: 602 VFVPISGLNGDNLKDPLNK 620


>UniRef50_Q4P6P7 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 965

 Score =  104 bits (250), Expect = 2e-21
 Identities = 54/129 (41%), Positives = 76/129 (58%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  +++VV+GHVD+GKST  G ++ + G + +R     E+ +Q+  K          +  
Sbjct: 527 KAELSLVVVGHVDAGKSTLMGRMLLELGSLSQREYSTNERASQKIGKGSFAYAWALDSSE 586

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G+TIDIA   F T     T++DAPGHRDFI NMI+G +QAD A+L+V +  G FE
Sbjct: 587 EERERGVTIDIAQDHFSTQHRTFTLLDAPGHRDFIPNMISGAAQADSALLVVDSIQGAFE 646

Query: 484 AGISKNGQT 510
           AG   NGQT
Sbjct: 647 AGFGPNGQT 655



 Score = 66.1 bits (154), Expect = 8e-10
 Identities = 49/158 (31%), Positives = 79/158 (50%), Gaps = 5/158 (3%)
 Frame = +3

Query: 255  MGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHH*CSWTQR-FHQEHDHRNL 431
            +GKGSF YAW LD  + ERE     R  ++++        H   +      H++     +
Sbjct: 571  IGKGSFAYAWALDSSEEERE-----RGVTIDIAQDHFSTQHRTFTLLDAPGHRDFIPNMI 625

Query: 432  SG*LRCAHRSCRYR*IR----SWYL*ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYS 599
            SG  +          I+    + +      REHALL  +LGV+QL+V VNK+D+    YS
Sbjct: 626  SGAAQADSALLVVDSIQGAFEAGFGPNGQTREHALLVRSLGVQQLVVVVNKLDAV--GYS 683

Query: 600  EPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNM 713
            + R++EI  +V  ++   G++ A + FVP  G  G+N+
Sbjct: 684  QERYDEIVGKVKPFLMSCGFDAAKLRFVPCGGSVGENL 721


>UniRef50_O74774 Cluster: Elongation factor 1 alpha related protein;
           n=1; Schizosaccharomyces pombe|Rep: Elongation factor 1
           alpha related protein - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 592

 Score =  103 bits (247), Expect = 5e-21
 Identities = 54/129 (41%), Positives = 74/129 (57%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  +++VV GHVDSGKST  G ++++ G I+ R+++K   EA    K   +         
Sbjct: 175 KPVVHLVVTGHVDSGKSTMLGRIMFELGEINSRSMQKLHNEAANSGKGSFSYAWLLDTTE 234

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              + G+T+D+A   FE+ K    I DAPGHRDFI  MI G S AD AVL+V +    FE
Sbjct: 235 EERARGVTMDVASTTFESDKKIYEIGDAPGHRDFISGMIAGASSADFAVLVVDSSQNNFE 294

Query: 484 AGISKNGQT 510
            G  +NGQT
Sbjct: 295 RGFLENGQT 303



 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 49/155 (31%), Positives = 70/155 (45%), Gaps = 1/155 (0%)
 Frame = +3

Query: 258 GKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLSG 437
           GKGSF YAW+LD  + ER R       S    + + +         + F         S 
Sbjct: 220 GKGSFSYAWLLDTTEEERARGVTMDVASTTFESDKKIYEIGDAPGHRDFISGMIAGASSA 279

Query: 438 *LRCAHRSCRYR*IRSWYL*ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEE 617
                            +L     REHA L   LG+ +++V VNK+D     +SE RF+E
Sbjct: 280 DFAVLVVDSSQNNFERGFLENGQTREHAYLLRALGISEIVVSVNKLDLMS--WSEDRFQE 337

Query: 618 IKKEVSSY-IKKIGYNPAAVAFVPISGWHGDNMLE 719
           IK  VS + IK +G+  + V FVPIS   G N+++
Sbjct: 338 IKNIVSDFLIKMVGFKTSNVHFVPISAISGTNLIQ 372


>UniRef50_Q95UT7 Cluster: Elongation factor 1 alpha short form; n=1;
           Monosiga brevicollis|Rep: Elongation factor 1 alpha
           short form - Monosiga brevicollis
          Length = 208

 Score =  102 bits (244), Expect = 1e-20
 Identities = 50/104 (48%), Positives = 67/104 (64%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K H++IV+ GHVD+GKSTTTG LI++ GGI +R ++K + EA+   K       Y    +
Sbjct: 5   KQHVSIVICGHVDAGKSTTTGRLIFELGGIPEREMQKLKDEAERLGKGSFAFAFYMDRQK 64

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQ 435
                G+TI     +F T+  + T+IDAPGHRDFIKNMITG SQ
Sbjct: 65  EERERGVTIACTTKEFFTATKHYTVIDAPGHRDFIKNMITGASQ 108


>UniRef50_Q23TC1 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 600

 Score =  101 bits (243), Expect = 1e-20
 Identities = 53/129 (41%), Positives = 73/129 (56%), Gaps = 2/129 (1%)
 Frame = +1

Query: 130 HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLS 309
           ++N+V++GHVDSGKST  GHL +    ID++   K EKE++   K+       W N    
Sbjct: 178 NMNLVIVGHVDSGKSTLVGHLCHLKKVIDQKLAHKNEKESKNIGKESFKFA--WVNDEFE 235

Query: 310 VSV--GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                GITIDI     +T    +T +DAPGH+DF+ NMI G +QAD A+L++      FE
Sbjct: 236 AERQRGITIDIGYKVIQTKNKNITFLDAPGHKDFVPNMIQGVTQADYALLVIEGSLQAFE 295

Query: 484 AGISKNGQT 510
            G    GQT
Sbjct: 296 RGFEFGGQT 304



 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 31/72 (43%), Positives = 48/72 (66%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EHA L   LGV++LIV +NKMD+    +   RFE IK E++ ++  IGY+   + FVPI
Sbjct: 305 KEHAFLVKQLGVQRLIVLINKMDTVN--WDRNRFEYIKLELTRFLTSIGYSEDNLIFVPI 362

Query: 690 SGWHGDNMLEPS 725
           S ++ +N++E S
Sbjct: 363 SAFYAENIVEKS 374


>UniRef50_Q9LM39 Cluster: T10O22.4; n=7; Magnoliophyta|Rep: T10O22.4
           - Arabidopsis thaliana (Mouse-ear cress)
          Length = 615

 Score =  101 bits (242), Expect = 2e-20
 Identities = 56/148 (37%), Positives = 87/148 (58%), Gaps = 18/148 (12%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE---------WVKDPS 273
           +K H+N+V IGHVD+GKST  G +++  G +D R I+K+EKEA++         ++ D +
Sbjct: 118 KKRHLNVVFIGHVDAGKSTIGGQILFLSGQVDDRQIQKYEKEAKDKSRESWYMAYIMDTN 177

Query: 274 N------MLGYWTN*RLSVSV-GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTS 432
                  +  +W+   L + + G T+++    FET     TI+DAPGH+ ++ NMI+G S
Sbjct: 178 EEERLKVLHVFWSMFVLLLKMHGKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGAS 237

Query: 433 QADCAVLI--VAAGTGEFEAGISKNGQT 510
           QAD  VL+  +    GEFE G  + GQT
Sbjct: 238 QADIGVLVSQLITRKGEFETGYERGGQT 265



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 1/69 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REH  LA TLGV +LIV VNKMD     +S+ R++EI++++  ++K  GYN    V F+P
Sbjct: 266 REHVQLAKTLGVSKLIVVVNKMDDPTVNWSKERYDEIEQKMVPFLKASGYNTKKDVVFLP 325

Query: 687 ISGWHGDNM 713
           ISG  G NM
Sbjct: 326 ISGLMGKNM 334


>UniRef50_P32769 Cluster: Elongation factor 1 alpha-like protein;
           n=2; Saccharomyces cerevisiae|Rep: Elongation factor 1
           alpha-like protein - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 611

 Score =  101 bits (242), Expect = 2e-20
 Identities = 49/127 (38%), Positives = 70/127 (55%)
 Frame = +1

Query: 130 HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLS 309
           H++ VV+GHVD+GKST  G L+Y    +++  + K ++E++   K               
Sbjct: 167 HLSFVVLGHVDAGKSTLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEE 226

Query: 310 VSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 489
              G+T+ I    F T +   TI+DAPGHRDF+ N I G SQAD A+L V   T  FE+G
Sbjct: 227 RERGVTVSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFESG 286

Query: 490 ISKNGQT 510
              +GQT
Sbjct: 287 FDLDGQT 293



 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 48/166 (28%), Positives = 80/166 (48%)
 Frame = +3

Query: 216 QTYHREVREGGPGMGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHH*CSWT 395
           Q+  R+++     MGK SFK+AW++D+   ERER      C+      +           
Sbjct: 196 QSQLRKLQRESETMGKSSFKFAWIMDQTNEERERGVTVSICTSHFSTHRANFTIVDAPGH 255

Query: 396 QRFHQEHDHRNLSG*LRCAHRSCRYR*IRSWYL*ERSNREHALLAFTLGVKQLIVGVNKM 575
           + F            +      C      S +  +   +EH LLA +LG+  LI+ +NKM
Sbjct: 256 RDFVPNAIMGISQADMAILCVDCSTNAFESGFDLDGQTKEHMLLASSLGIHNLIIAMNKM 315

Query: 576 DSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNM 713
           D+ +  +S+ RFEEIK ++  Y+  IG+    + +VPISG+ G+ +
Sbjct: 316 DNVD--WSQQRFEEIKSKLLPYLVDIGFFEDNINWVPISGFSGEGV 359


>UniRef50_Q4E4V1 Cluster: Elongation factor 1-alpha (EF-1-alpha),
           putative; n=3; Trypanosoma|Rep: Elongation factor
           1-alpha (EF-1-alpha), putative - Trypanosoma cruzi
          Length = 664

 Score =  101 bits (241), Expect = 2e-20
 Identities = 50/124 (40%), Positives = 70/124 (56%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K     V+ GHVD+GKSTT GHL+   G + +  IEK EK A++                
Sbjct: 245 KRDCTFVIAGHVDAGKSTTLGHLLLLLGKVSQSEIEKNEKNARQLNSGSFKYAWVLDQSE 304

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G+TID   + FET    + I+DAPGH+D++ NMI+  +QAD A+L+V A T EFE
Sbjct: 305 EERRRGVTIDAGSYCFETEHRRINILDAPGHKDYVLNMISSATQADAALLVVTAATSEFE 364

Query: 484 AGIS 495
            G++
Sbjct: 365 VGLA 368



 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 1/70 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGY-NPAAVAFVP 686
           +EH  +  TL V +LIV VNKMD+ +  YS+ R++ + +E+   +K+I Y   A V F P
Sbjct: 372 KEHLFILKTLSVGRLIVAVNKMDTVD--YSKERYDYVVRELKFLLKQIRYKEEAVVGFCP 429

Query: 687 ISGWHGDNML 716
           +SG  G N+L
Sbjct: 430 VSGMQGTNIL 439


>UniRef50_Q4FW53 Cluster: Hsp70 subfamily B suppressor 1; n=3;
           Leishmania|Rep: Hsp70 subfamily B suppressor 1 -
           Leishmania major strain Friedlin
          Length = 647

 Score =  100 bits (239), Expect = 4e-20
 Identities = 52/125 (41%), Positives = 70/125 (56%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           KEK     V+ GHVD+GKSTT GHL+   G +  + +E+ EK  +   KD          
Sbjct: 223 KEKPDCTFVIAGHVDAGKSTTLGHLLLLLGRVSIQDVERNEKADRTHHKDSFKYAWLLDQ 282

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
                  G+TID   + FET    V I+DAPGH+DF+ NMI+  +QAD A+L+V A   E
Sbjct: 283 CEEERRRGVTIDSGSFCFETEHRRVHILDAPGHKDFVLNMISSATQADAALLVVTATNSE 342

Query: 478 FEAGI 492
           FE G+
Sbjct: 343 FETGL 347



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGY-NPAAVAFVP 686
           + H L+  TLGV  ++V VNKMD+    YS+ R++ + +E+   +K+      A + F P
Sbjct: 352 KSHLLVLKTLGVGSIVVAVNKMDAV--AYSQERYDYVVRELQLLLKQTRIPEEAIIGFCP 409

Query: 687 ISGWHGDNMLEPSTK 731
           ISG  G N+ +   K
Sbjct: 410 ISGMTGVNITQRGAK 424


>UniRef50_A0E926 Cluster: Chromosome undetermined scaffold_84, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_84,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 756

 Score =  100 bits (239), Expect = 4e-20
 Identities = 51/126 (40%), Positives = 75/126 (59%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +N+V IGHVD+GKST  G L+ + G + +  I+K+E+EA +  +D   +           
Sbjct: 329 VNLVFIGHVDAGKSTLCGRLLLELGEVSEADIKKYEQEAVQNNRDSWWLAYVMDQNEEEK 388

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 492
             G T++    +F T +    + DAPGH++++ NMI G  QAD A LIV+A TGEFE+G 
Sbjct: 389 QKGKTVECGKAQFVTKQKRFILADAPGHKNYVPNMIMGACQADLAGLIVSAKTGEFESGF 448

Query: 493 SKNGQT 510
            K GQT
Sbjct: 449 EKGGQT 454



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYI-KKIGYNPAAVAFVP 686
           +EHALLA +LGV  +I+ V KMD+ +  +++ RF  I + +  ++ K+  ++   V  +P
Sbjct: 455 QEHALLAKSLGVDHIIIIVTKMDTID--WNQDRFNLISQNIQEFVLKQCKFDNIYV--IP 510

Query: 687 ISGWHGDNM 713
           I    G N+
Sbjct: 511 IDALSGSNI 519


>UniRef50_Q5KLM5 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 914

 Score =   99 bits (238), Expect = 6e-20
 Identities = 53/131 (40%), Positives = 75/131 (57%), Gaps = 2/131 (1%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K +++++V+GHVD+GKST  G ++Y  G + ++  EK   E         +    W    
Sbjct: 481 KKNVSLIVVGHVDAGKSTLMGRVLYDIGELSEK--EKIANERGSKKLGKGSFAFAWGLDA 538

Query: 304 LSVSV--GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
           L      G+TIDIA   F T     T++DAPGHRDFI  MI+G +QAD A+L++    GE
Sbjct: 539 LGDERDRGVTIDIATTHFVTPHRNFTLLDAPGHRDFIPAMISGAAQADVALLVIDGSPGE 598

Query: 478 FEAGISKNGQT 510
           FEAG  + GQT
Sbjct: 599 FEAGFERGGQT 609



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 29/70 (41%), Positives = 45/70 (64%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHA L  +LGVK++IVGVNKMD     +S+ R+EEI + +  ++   G+N     F+P+
Sbjct: 610 REHAWLVRSLGVKEIIVGVNKMDLVS--WSQDRYEEIVESLKPFLLSAGFNSTKTTFLPL 667

Query: 690 SGWHGDNMLE 719
           +   G N+L+
Sbjct: 668 AAMEGINILD 677


>UniRef50_UPI00006CC36B Cluster: Elongation factor Tu C-terminal
           domain containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 441

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 48/131 (36%), Positives = 78/131 (59%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           ++K  I + VIG++ SGKST  GHL  + G ++ + +++ ++  +E  +D  N       
Sbjct: 7   QKKERITLAVIGNIGSGKSTMCGHLAIQLGQVNDQKLKEVKQACEEEGQDGINYSYIMDT 66

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
            ++      +ID +++ FET K+ +TIID PG   + KNM+TG   AD AVL+++A   E
Sbjct: 67  KKVERQRKQSIDTSIFHFETDKFQITIIDTPGDTQYTKNMMTGICLADAAVLMISAAADE 126

Query: 478 FEAGISKNGQT 510
           FE G  K+GQT
Sbjct: 127 FEKGFGKDGQT 137



 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 33/75 (44%), Positives = 50/75 (66%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           ++  L ++ LG+KQ+IV +NKMD ++  + + RF EIKKEV    +KI +N   + F+PI
Sbjct: 138 KDFILHSYALGIKQMIVCINKMDDSKYSFCQKRFNEIKKEVKQQFEKINFNLQNIKFIPI 197

Query: 690 SGWHGDNMLEPSTKM 734
           S + GDN+LE S  M
Sbjct: 198 SAFLGDNLLEKSPNM 212


>UniRef50_Q8SRN3 Cluster: TRANSLATION ELONGATION FACTOR 1-ALPHA;
           n=1; Encephalitozoon cuniculi|Rep: TRANSLATION
           ELONGATION FACTOR 1-ALPHA - Encephalitozoon cuniculi
          Length = 424

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 50/129 (38%), Positives = 73/129 (56%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  INIV +GHVD+GKST  G ++ + G +D RT+EK+ + ++E  ++   +        
Sbjct: 11  KKVINIVFVGHVDAGKSTICGQILVQMGLVDPRTLEKYRQMSREQNRESWYLSWCLDTNP 70

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                G T ++    FE     V I+DAPGH  F+  MI G ++AD  +L+V+A   EFE
Sbjct: 71  EERERGKTTEVGTASFELPHRRVNILDAPGHNQFVFEMINGANRADVGILVVSARINEFE 130

Query: 484 AGISKNGQT 510
           AG  K GQT
Sbjct: 131 AGFEKGGQT 139



 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 26/70 (37%), Positives = 43/70 (61%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH  L     V++LIV VNKMD     + + RF+EIK +V ++++++   P    F+P+
Sbjct: 140 REHIFLLKAGSVQRLIVLVNKMDDPSVEWRKERFDEIKTKVGAFVRRMFPTP---VFIPV 196

Query: 690 SGWHGDNMLE 719
           SG+ G+ + E
Sbjct: 197 SGFTGEYIKE 206


>UniRef50_A5JHE1 Cluster: Translation elongation factor EF-1 alpha
           subunit; n=2; Euryarchaeota|Rep: Translation elongation
           factor EF-1 alpha subunit - Methanohalophilus
           portucalensis
          Length = 354

 Score = 97.5 bits (232), Expect = 3e-19
 Identities = 49/95 (51%), Positives = 62/95 (65%)
 Frame = +1

Query: 190 LIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGITIDIALWKFETSKYY 369
           L+Y  G I +  I+KF +EA+E  K+         + +     GITIDIA  +F+T KYY
Sbjct: 5   LLYXTGAIPQHIIDKFREEAKEKGKESFAFAWVMDSLKEERERGITIDIAHKRFDTDKYY 64

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            TI+D PGHRDF+KNMITG SQAD AVL+VAA  G
Sbjct: 65  FTIVDCPGHRDFVKNMITGASQADAAVLVVAATDG 99



 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 32/73 (43%), Positives = 51/73 (69%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EH  L+ TLG+ QLI+ VNKMD+T+  YSE ++ ++KK+VS  +  +G+  A V F+P 
Sbjct: 105 KEHVFLSRTLGINQLIIAVNKMDATD--YSEDKYNQVKKDVSELLGMVGFKAADVPFIPT 162

Query: 690 SGWHGDNMLEPST 728
           S + GDN+ + S+
Sbjct: 163 SAFEGDNISKNSS 175


>UniRef50_A5X901 Cluster: Elongation factor 1-alpha; n=2;
           Chilodonella uncinata|Rep: Elongation factor 1-alpha -
           Chilodonella uncinata
          Length = 403

 Score = 96.3 bits (229), Expect = 7e-19
 Identities = 53/120 (44%), Positives = 72/120 (60%), Gaps = 4/120 (3%)
 Frame = +1

Query: 163 SGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSN----MLGYWTN*RLSVSVGITI 330
           SGKST   HL Y CGG+D+RT   ++++ +     P +    M  Y T+      +GI  
Sbjct: 1   SGKSTIVAHLAYLCGGLDRRTRMDYDEQRKLMGDKPLSFGWLMDRYRTDRDRYREIGI-- 58

Query: 331 DIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 510
           DI   +  T      ++DAPGHRDF+K++ITG  QAD  +L+V A  GEFEAGISK+GQT
Sbjct: 59  DIHKTQIYTENRNYMLVDAPGHRDFVKSLITGVCQADFCLLVVVAAAGEFEAGISKDGQT 118



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 37/75 (49%), Positives = 46/75 (61%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           RE ALLA+TLGVKQ IV V+KMD     YS+ RF EI+ E+     K+G     + FV I
Sbjct: 119 REQALLAYTLGVKQFIVVVSKMDHKSVNYSQIRFAEIQTEIRLMFTKMGVKADQIPFVAI 178

Query: 690 SGWHGDNMLEPSTKM 734
           S W GDN+ + S  M
Sbjct: 179 SAWFGDNIKDRSGNM 193


>UniRef50_Q2ABX8 Cluster: Elongation factor 1-alpha; n=1; Megacopta
           punctatissima|Rep: Elongation factor 1-alpha - Megacopta
           punctatissima
          Length = 187

 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 41/45 (91%), Positives = 43/45 (95%)
 Frame = +3

Query: 600 EPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKM 734
           + RFEEIKKEVSSYIKKIGYNPA+VAFVPISGWHGDNMLEPS KM
Sbjct: 31  QSRFEEIKKEVSSYIKKIGYNPASVAFVPISGWHGDNMLEPSDKM 75


>UniRef50_Q6CFF3 Cluster: Similar to tr|Q9WTY5 Mus musculus ERFS;
           n=1; Yarrowia lipolytica|Rep: Similar to tr|Q9WTY5 Mus
           musculus ERFS - Yarrowia lipolytica (Candida lipolytica)
          Length = 518

 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 46/126 (36%), Positives = 68/126 (53%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +N V +GHVD+GKST  G L++  G +    +EK  K A E  K   +            
Sbjct: 77  LNAVAVGHVDAGKSTLLGRLLHDTGVVSSHQVEKLAKSASEIGKKSFSYAWLMDQTDEER 136

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 492
             G+T+DI++ +F        I+DAPGH +F+ NMI G SQAD A++++ +    FE G 
Sbjct: 137 ENGVTVDISVREFSYESREYFILDAPGHYNFVPNMIAGASQADVAIVVLDSLADAFERGF 196

Query: 493 SKNGQT 510
             +GQT
Sbjct: 197 FADGQT 202



 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 29/70 (41%), Positives = 46/70 (65%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EHALL   +GV  +I+ VNKMD  +  + + RF+EI  ++  ++ KIGY+   V FVP 
Sbjct: 203 KEHALLCRAMGVNHVIIAVNKMDQLK--FDQTRFDEISDQMGLFLSKIGYSD--VQFVPC 258

Query: 690 SGWHGDNMLE 719
           SG+ G N+++
Sbjct: 259 SGFTGANIVK 268


>UniRef50_Q97MT1 Cluster: GTPase, sulfate adenylate transferase
           subunit 1; n=2; Clostridium|Rep: GTPase, sulfate
           adenylate transferase subunit 1 - Clostridium
           acetobutylicum
          Length = 522

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 49/119 (41%), Positives = 73/119 (61%), Gaps = 2/119 (1%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK-EAQEWVK-DPSNMLGYWTN 297
           + ++N+V +GHVD GKST  G L+Y    +    IEK +K  A+E  K + + +L  +  
Sbjct: 4   RENLNVVFVGHVDHGKSTLIGRLLYDTNSLPDGAIEKVKKISAEEGKKFEYAFLLDAFEE 63

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            +     GITIDI + +F T K    IIDAPGH++F+KNMI+G + A+ A+L+V A  G
Sbjct: 64  EQRQ---GITIDITMIQFFTKKRDYVIIDAPGHKEFLKNMISGAASAEAAILVVDAKEG 119



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 28/79 (35%), Positives = 47/79 (59%)
 Frame = +3

Query: 498 ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVA 677
           +  ++ H  +   LG+K++ V VNKMD  +  YSE R+ EI  + +S++  +   P   A
Sbjct: 121 QEQSKRHGYILSLLGIKKVYVAVNKMDLVD--YSEERYNEIVTQFNSFLANLNIYPE--A 176

Query: 678 FVPISGWHGDNMLEPSTKM 734
           ++PIS + GDN+ + S KM
Sbjct: 177 YIPISAFLGDNVAKKSEKM 195


>UniRef50_A4XJZ8 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Caldicellulosiruptor saccharolyticus DSM
           8903|Rep: Sulfate adenylyltransferase, large subunit -
           Caldicellulosiruptor saccharolyticus (strain ATCC 43494
           / DSM 8903)
          Length = 564

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 44/114 (38%), Positives = 65/114 (57%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           + IVV+GHVD GKST  G L+Y    + +  IE+ ++ ++E  + P              
Sbjct: 7   LKIVVVGHVDHGKSTIIGRLLYDTKSVPEAAIERVKRISKEKGR-PFEYAYLLDALEEEQ 65

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             GITID    KF T K    IIDAPGH++F+KNM++G + A+ A+L++ A  G
Sbjct: 66  KQGITIDTTQIKFSTPKRDYLIIDAPGHKEFLKNMVSGAANAEAALLVIDAAEG 119



 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 29/79 (36%), Positives = 51/79 (64%)
 Frame = +3

Query: 498 ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVA 677
           +  ++ HA +   LG++++ V VNKMD  E  +SE +F+EIK E+S+++ K+   P    
Sbjct: 121 QEQSKRHAYILSLLGIQKVYVIVNKMDMIE--FSEKKFKEIKYEISTFLSKLNVYPQ--K 176

Query: 678 FVPISGWHGDNMLEPSTKM 734
           ++P+SG+ G+N+   S KM
Sbjct: 177 YIPVSGFLGENIARKSDKM 195


>UniRef50_A6TTV2 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Alkaliphilus metalliredigens QYMF|Rep:
           Sulfate adenylyltransferase, large subunit -
           Alkaliphilus metalliredigens QYMF
          Length = 615

 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 44/118 (37%), Positives = 72/118 (61%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +++++NIV++GHVD GKST  G L+   G + +  +E+ ++  ++  K P          
Sbjct: 17  QQSNMNIVIVGHVDHGKSTIIGRLLADTGSLPEGKLEQVKETCRKNAK-PFEYAFLLDAL 75

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +   S GITID A   F+T +    IIDAPGH +F+KNM+TG ++A+ A+L++ A  G
Sbjct: 76  KDEQSQGITIDSARVFFKTQERKYIIIDAPGHIEFLKNMVTGAARAEVALLVIDAKEG 133



 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 30/79 (37%), Positives = 51/79 (64%)
 Frame = +3

Query: 498 ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVA 677
           + +++ H  L   LG+KQ++V +NKMD  +  YS+ R+EEI  E  +++ +I  +  A +
Sbjct: 135 KENSKRHGYLLSMLGIKQVVVLINKMDLVD--YSKERYEEILAEYKAFLSEI--DVEAES 190

Query: 678 FVPISGWHGDNMLEPSTKM 734
           F+PISG+ G+N+   S KM
Sbjct: 191 FIPISGFKGENVASGSDKM 209


>UniRef50_Q89UE2 Cluster: NodQ bifunctional enzyme; n=12;
           Rhizobiales|Rep: NodQ bifunctional enzyme -
           Bradyrhizobium japonicum
          Length = 638

 Score = 82.6 bits (195), Expect = 9e-15
 Identities = 46/120 (38%), Positives = 64/120 (53%)
 Frame = +1

Query: 115 GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWT 294
           G  +  + IV++GHVD GKST  G L+++ G +    +E   K        P        
Sbjct: 15  GTTRPQVRIVIVGHVDHGKSTLVGRLLHETGSLPDGKLEML-KAVSARRGMPFEWSFLLD 73

Query: 295 N*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             +     GITID    +F T+   + +IDAPGH +F++NMITG SQAD AVLI+ A  G
Sbjct: 74  ALQTERDQGITIDTTQIRFRTNSRDIVLIDAPGHAEFLRNMITGASQADGAVLIIDALEG 133



 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 28/68 (41%), Positives = 40/68 (58%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R H  L   LGVKQ+ + VNKMD  +  +S  RF+ I  E+S+++  +G  P AV  +PI
Sbjct: 139 RRHGYLLHLLGVKQVAIVVNKMDRVD--FSADRFQAISDEISAHLNGLGVTPTAV--IPI 194

Query: 690 SGWHGDNM 713
           S   GD +
Sbjct: 195 SARDGDGV 202


>UniRef50_Q24TA2 Cluster: Adenylylsulfate kinase/sulfate
           adenylyltransferase subunit 1; n=5; Bacteria|Rep:
           Adenylylsulfate kinase/sulfate adenylyltransferase
           subunit 1 - Desulfitobacterium hafniense (strain Y51)
          Length = 614

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 44/117 (37%), Positives = 68/117 (58%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           +  +NIV++GHVD GKST  G L+   G + +  +E  ++  ++  + P          +
Sbjct: 20  REQMNIVIVGHVDHGKSTVIGRLLADTGSLPEGKLEAVQEYCRKNAR-PFEYAFLLDALK 78

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
              + GITID A   F+T K    IIDAPGH +F+KNM+TG S+A+ A+L++ A  G
Sbjct: 79  DEQAQGITIDTARSFFKTGKRDYIIIDAPGHIEFLKNMVTGASRAEAALLVIDAKEG 135



 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 24/70 (34%), Positives = 44/70 (62%)
 Frame = +3

Query: 504 SNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFV 683
           +++ H  +A  LG++Q++V VNKMD  +  +    FE I++E   ++ K+   P  V F+
Sbjct: 139 NSKRHGHIAAMLGIRQVVVLVNKMDLVD--FDRQTFETIRREFGEFLHKLNIQP--VNFI 194

Query: 684 PISGWHGDNM 713
           P+S ++GDN+
Sbjct: 195 PLSAFNGDNI 204


>UniRef50_A4RWT6 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 481

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 40/122 (32%), Positives = 69/122 (56%), Gaps = 1/122 (0%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +++V++GHVD+GKST +G L+Y    +D R + K  ++++   K                
Sbjct: 45  VHVVILGHVDAGKSTLSGRLMYALKAVDDRAMHKNVRDSKASGKSSFAWAWVMDCRPEER 104

Query: 313 SVGITIDIALWKFETSKY-YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 489
             G+TID+++ +     +  + ++DAPGH+DF+ N I+G SQAD  VL++    G FE G
Sbjct: 105 ERGVTIDVSMKRCVLDGHRQLVVLDAPGHKDFVPNAISGASQADAGVLVIDGAMGGFENG 164

Query: 490 IS 495
            +
Sbjct: 165 FA 166



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSY-IKKIGYNPAAVAFVP 686
           REHA LA  LG+  LIV +NKMD  E  Y E RF  +   + ++ I  +G++   + FVP
Sbjct: 176 REHARLARALGLHSLIVVINKMDCVE--YGEERFRFVVDALQNFLIDDVGFSQEQLTFVP 233

Query: 687 ISGWHGDNM 713
           +SG  G N+
Sbjct: 234 VSGIEGTNI 242


>UniRef50_UPI0000499770 Cluster: elongation factor-1alpha; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: elongation
           factor-1alpha - Entamoeba histolytica HM-1:IMSS
          Length = 544

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 41/112 (36%), Positives = 62/112 (55%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           +T + ++  GHVDSGKSTT GH++ + GG+    IEK +KE  E  K             
Sbjct: 130 QTPLTVIFCGHVDSGKSTTVGHILQELGGVTHSQIEKNKKECGEKGKKSFEYAWVMDTDD 189

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 459
              + GITI +   +F+ +   + I+DAPGH DF+   I   ++AD AV++V
Sbjct: 190 EERNRGITISVGAVEFQYNHKNIRILDAPGHTDFLMKTIDAMNEADVAVVVV 241



 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 19/62 (30%), Positives = 39/62 (62%)
 Frame = +3

Query: 543 VKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEP 722
           V ++IV +NKMDS +  +SE +++ +       +K+   +   + ++PISG  G+N+++P
Sbjct: 268 VSKIIVAINKMDSVK--WSESKYKSVVSVAEELLKEYNLDNINIRYIPISGLSGENLIKP 325

Query: 723 ST 728
           +T
Sbjct: 326 TT 327


>UniRef50_A0BL72 Cluster: Chromosome undetermined scaffold_113,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_113,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 609

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 47/140 (33%), Positives = 77/140 (55%), Gaps = 1/140 (0%)
 Frame = +1

Query: 88  YP*LH*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKD 267
           YP +    + +     +IV++GHVD+GKST TG L+     +D + + K +K+A+   K+
Sbjct: 160 YPSIKYKNVVQSNPSTSIVILGHVDTGKSTLTGRLLQVFKALDDKELRKNQKDAKNLGKE 219

Query: 268 PSNMLGYWTN*-RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADC 444
            S+ L Y T+  +     G+T+D+A            ++D+PGH+DF   +I G +QAD 
Sbjct: 220 -SSALAYATDMTKEEKEKGVTMDMAYKTVVIGGRQYNLLDSPGHQDFAPYLIAGAAQADY 278

Query: 445 AVLIVAAGTGEFEAGISKNG 504
           A+L+V      FE  I K+G
Sbjct: 279 AILVVDTTKNAFENSI-KSG 297



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/68 (30%), Positives = 38/68 (55%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           RE   L   + +K+++V +NKMD  +  + + +F+  K  +     K+GYN   + F+PI
Sbjct: 300 REKLQLISAMLIKEIVVALNKMDQID--WDQKQFDVAKDYIKVSAAKLGYNQKQIKFIPI 357

Query: 690 SGWHGDNM 713
           S + G N+
Sbjct: 358 SAFQGLNI 365


>UniRef50_Q8IE20 Cluster: Elongation factor tu, putative; n=9;
           Aconoidasida|Rep: Elongation factor tu, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 505

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 46/119 (38%), Positives = 66/119 (55%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           ++K H+NI  IGHVD GK+T T  +   C  +++   + +E    E  K P         
Sbjct: 117 RKKPHMNIGTIGHVDHGKTTLTAAITKVCSDLNRGVFKSYE----EIDKTPEEQ------ 166

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                  GITI+    ++ET K + + ID PGH D+IKNMITGTSQ D ++L+V+A  G
Sbjct: 167 -----KRGITINATHVEYETEKRHYSHIDCPGHLDYIKNMITGTSQMDGSILVVSAYDG 220


>UniRef50_Q74CF6 Cluster: Elongation factor Tu GTP binding domain
           protein; n=1; Geobacter sulfurreducens|Rep: Elongation
           factor Tu GTP binding domain protein - Geobacter
           sulfurreducens
          Length = 516

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 48/123 (39%), Positives = 68/123 (55%), Gaps = 2/123 (1%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK--EAQEWVKDPSNMLG 285
           M + +T + IV++GHVD GKST  G L Y  G I +   ++     +AQ    + + ++ 
Sbjct: 1   MSQSET-LKIVIVGHVDHGKSTLIGRLFYDTGSIPEARRQEIAATCKAQGRPFEFAYLMD 59

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                R+     ITID A   F TS+    IIDAPGH+ F+KNMITG + AD A+L+V  
Sbjct: 60  ALEEERVQ---NITIDTASSFFSTSRRRYVIIDAPGHKQFLKNMITGAASADAAILLVDG 116

Query: 466 GTG 474
             G
Sbjct: 117 TEG 119



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 23/68 (33%), Positives = 42/68 (61%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           + HA +   LG++Q++V VNK+D  +  Y   RF+E++ ++ +++  +   PA V  +PI
Sbjct: 125 KRHAHVLSLLGIRQVVVAVNKLDMID--YDRQRFQEVENDIRAFLHSLHIVPAHV--IPI 180

Query: 690 SGWHGDNM 713
           S   G+NM
Sbjct: 181 SAREGENM 188


>UniRef50_Q7R087 Cluster: GLP_56_7099_8961; n=2; Giardia
           intestinalis|Rep: GLP_56_7099_8961 - Giardia lamblia
           ATCC 50803
          Length = 620

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 47/141 (33%), Positives = 70/141 (49%), Gaps = 10/141 (7%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           K +  IN++V+GHVD+GKST  GHL    G +  R   + +  A  + K   +       
Sbjct: 139 KSRNTINVLVVGHVDAGKSTIFGHLAVLSGSVSMRERTRTQALADTYNKSTFSYAFLLDT 198

Query: 298 *RLSVSVGITIDIA----------LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCA 447
                  G+T+D+           L    +  + V + D PGHRDF+ ++I   SQ D A
Sbjct: 199 NDEERQRGVTMDVCNHTLTLAFPELGDNYSVPHTVFLQDCPGHRDFVPSLIRAVSQPDAA 258

Query: 448 VLIVAAGTGEFEAGISKNGQT 510
           VL++ A   EFE G+S +GQT
Sbjct: 259 VLVLDASPKEFEKGLSDDGQT 279



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/62 (38%), Positives = 36/62 (58%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH  L    GVK ++V VNK+D T+  ++E RF EI   ++  ++K       V F+P+
Sbjct: 280 REHLQLLMIFGVKHIMVAVNKLDRTD--WNEGRFVEIVTVLTKVLRKDIQFGGEVTFIPV 337

Query: 690 SG 695
           SG
Sbjct: 338 SG 339


>UniRef50_UPI0000F308E4 Cluster: UPI0000F308E4 related cluster; n=3;
           Laurasiatheria|Rep: UPI0000F308E4 UniRef100 entry - Bos
           Taurus
          Length = 428

 Score = 77.0 bits (181), Expect = 5e-13
 Identities = 44/95 (46%), Positives = 51/95 (53%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           K KT    ++ GHVD GKS TTGH IYKC GIDK   EK      E  K     +     
Sbjct: 3   KNKTRCVSIINGHVDLGKSPTTGHRIYKCDGIDKTATEK-RTRLPETGKGSFESISGSDT 61

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRD 402
            R     GIT  I+L +F+TS+ YVTI DA  HRD
Sbjct: 62  LRAESKCGITTGISLRQFKTSRGYVTITDASRHRD 96



 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 37/73 (50%), Positives = 48/73 (65%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           RE AL   TLGVKQL V   K+DS +PP S+ +  +  KEVS+++KK G+NP      P 
Sbjct: 119 RERALHTHTLGVKQLSVSATKVDS-QPPCSQKKTRK-SKEVSTHVKKTGFNPDTACVSP- 175

Query: 690 SGWHGDNMLEPST 728
           SGW+GD+MLE  T
Sbjct: 176 SGWNGDDMLESRT 188


>UniRef50_Q259E7 Cluster: H0801D08.2 protein; n=5; Oryza sativa|Rep:
           H0801D08.2 protein - Oryza sativa (Rice)
          Length = 654

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 29/62 (46%), Positives = 46/62 (74%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 498
           GIT+ + +  F+T  Y+V ++D+PGH+DF+ NMI+G +Q+D A+L++ A  G FEAG+  
Sbjct: 297 GITMTVGVAYFDTKNYHVVLLDSPGHKDFVPNMISGATQSDAAILVIDASIGSFEAGMGI 356

Query: 499 NG 504
           NG
Sbjct: 357 NG 358



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 31/69 (44%), Positives = 46/69 (66%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EH+ L  + GV  LIV VNKMDS E  YS+ RF  IK ++ ++++  GY  +AVA+VPI
Sbjct: 363 KEHSQLVRSFGVDNLIVVVNKMDSVE--YSKERFNFIKSQLGAFLRSCGYKDSAVAWVPI 420

Query: 690 SGWHGDNML 716
           S    +N++
Sbjct: 421 SAMENENLM 429



 Score = 33.5 bits (73), Expect = 5.5
 Identities = 13/21 (61%), Positives = 16/21 (76%)
 Frame = +3

Query: 255 MGKGSFKYAWVLDKLKAERER 317
           +GKGSF YAW +D+   ERER
Sbjct: 276 IGKGSFAYAWAMDESADERER 296


>UniRef50_UPI0000EB403C Cluster: UPI0000EB403C related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB403C UniRef100
           entry - Canis familiaris
          Length = 300

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 38/65 (58%), Positives = 47/65 (72%)
 Frame = +3

Query: 540 GVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLE 719
           G+KQLIVG  K+D TE  YS+ R +E  +E S+YIKKIGY+P  VAF  IS W+GD+M E
Sbjct: 1   GMKQLIVGGGKVDFTESSYSQKRDKEPVRE-STYIKKIGYHPDTVAFASISIWNGDDMPE 59

Query: 720 PSTKM 734
           PS  M
Sbjct: 60  PSANM 64


>UniRef50_Q5CWA0 Cluster: HBS1 eRFS. GTpase; n=2;
           Cryptosporidium|Rep: HBS1 eRFS. GTpase - Cryptosporidium
           parvum Iowa II
          Length = 530

 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 46/124 (37%), Positives = 69/124 (55%)
 Frame = +1

Query: 142 VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVG 321
           VV+GHVDSGKST  GHL    G I +  + K++KE++   K        + +       G
Sbjct: 85  VVLGHVDSGKSTLMGHLFVSLGLISEGVMRKYKKESEIIGKGSFAYAWIFDDCDDERERG 144

Query: 322 ITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKN 501
           ITI+I+       K  VTI+DAPGH +FI N  + +  +D  +++V   +G F++G  K 
Sbjct: 145 ITINISAKSMMIEKKLVTILDAPGHSEFIPNSFSISMFSD-NIIVVIDSSG-FDSGFQK- 201

Query: 502 GQTV 513
           GQT+
Sbjct: 202 GQTI 205



 Score = 37.1 bits (82), Expect = 0.45
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 3/71 (4%)
 Frame = +3

Query: 513 EHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIK-KIG--YNPAAVAFV 683
           EH + +    V  +I  VNK+D     + E  +  I   +S+YI  ++    N + + F+
Sbjct: 206 EHIIYSLLADVSNIIFAVNKLDLCN--WDEQVYSNIVNTISNYINLELADIKNDSNIIFL 263

Query: 684 PISGWHGDNML 716
           PIS +HG N+L
Sbjct: 264 PISAYHGVNIL 274


>UniRef50_Q19AS6 Cluster: Translation elongation factor 1 alpha;
           n=7; Fungi/Metazoa group|Rep: Translation elongation
           factor 1 alpha - Fusarium sp. CBS 100485
          Length = 61

 Score = 73.3 bits (172), Expect = 6e-12
 Identities = 37/59 (62%), Positives = 39/59 (66%)
 Frame = +1

Query: 181 TGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGITIDIALWKFET 357
           TGHLIY+CGGIDKRTIEKFEKEA E  K            +     GITIDIALWKFET
Sbjct: 1   TGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFET 59


>UniRef50_Q5FSE8 Cluster: Sulfate adenylyltransferase subunit 1 /
           adenylylsulfate kinase; n=1; Gluconobacter oxydans|Rep:
           Sulfate adenylyltransferase subunit 1 / adenylylsulfate
           kinase - Gluconobacter oxydans (Gluconobacter
           suboxydans)
          Length = 626

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 41/116 (35%), Positives = 61/116 (52%), Gaps = 1/116 (0%)
 Frame = +1

Query: 139 IVVIGHVDSGKSTTTGHLIYKCGGI-DKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           IV++GHVD GKST  G L+Y    + D +  +  E   +  +    + L    + ++   
Sbjct: 21  IVIVGHVDHGKSTLIGRLLYDTDSLQDGKLAQIVESSRKRGLAVEWSFL--LDSLQIERD 78

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
            G+T+D     F        I+DAPGHR F++NMITG + A+ AVL+V A  G  E
Sbjct: 79  QGVTVDSTRIPFRLGSREFVIVDAPGHRQFLRNMITGAADAEAAVLVVDAKEGAQE 134



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 21/78 (26%), Positives = 39/78 (50%)
 Frame = +3

Query: 498 ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVA 677
           +   R HA+L   +G++ +IV +NK D     + E +  +++ +V   + ++     AV 
Sbjct: 133 QEQTRRHAMLLRLIGIRHVIVLLNKSDIL--GFDEAQIVKVESDVRQLLGRLEIEVEAV- 189

Query: 678 FVPISGWHGDNMLEPSTK 731
            VP S   GDN+   S +
Sbjct: 190 -VPASARDGDNIASRSER 206


>UniRef50_Q46516 Cluster: ORFC 179; n=1; Desulfurococcus
           mobilis|Rep: ORFC 179 - Desulfurococcus mobilis
          Length = 179

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 54/122 (44%), Positives = 59/122 (48%)
 Frame = -2

Query: 503 PFLEIPASNSPVPAATMSTAQSA*EVPVIMFLMKSLCPGASMMVT*YLLVSNFQRAISIV 324
           P   IPASNSP  A T   A SA   PVIMFL KSL PGASMMV  Y  VSNF     IV
Sbjct: 28  PSALIPASNSPFLALTTRIAASAWLAPVIMFLTKSLWPGASMMVKKYFFVSNFMYDSDIV 87

Query: 323 IPTLTLSL*FVQYPSIFEGSFTHSWASFSNFSMVRLSIPPHL*IK*PVVVDLPESTCPMT 144
            P    S       +  + S      S S    V  S  P      PV+V LP STCP+ 
Sbjct: 88  TPRSRSSFILSSSHANLKLSLPIFLDSSSIIFTVFSSKYPRRYSMCPVIVLLPWSTCPII 147

Query: 143 TM 138
           T+
Sbjct: 148 TI 149


>UniRef50_A4LX06 Cluster: Sulfate adenylyltransferase; n=1;
           Geobacter bemidjiensis Bem|Rep: Sulfate
           adenylyltransferase - Geobacter bemidjiensis Bem
          Length = 408

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 46/122 (37%), Positives = 63/122 (51%), Gaps = 2/122 (1%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDP--SNMLGYWTN 297
           K+   I + GHVD GKST  G L+Y  G +     ++  + + E  +    + +L  +  
Sbjct: 6   KSAFPIAITGHVDHGKSTLIGRLLYDTGTLQSGRYQEMLQSSLETGRGDEFAFVLDAFEE 65

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
            R     GITID +   F +      IID PGHR+FI+NM+TG S A  AVLIV A  G 
Sbjct: 66  ERRR---GITIDTSQIYFNSKLRPYLIIDTPGHREFIRNMVTGASYAKAAVLIVDAVEGV 122

Query: 478 FE 483
            E
Sbjct: 123 ME 124



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 29/75 (38%), Positives = 41/75 (54%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R HA L   +G++++ V VNKMD+    YS   F  +   V S   + G +PAA+  VPI
Sbjct: 127 RRHAWLLSIVGIQEICVAVNKMDAV--AYSSDAFAALSVAVESLFTEFGLSPAAI--VPI 182

Query: 690 SGWHGDNMLEPSTKM 734
           S   GDN+ + S  M
Sbjct: 183 SARVGDNVAKLSGSM 197


>UniRef50_Q7M9D1 Cluster: GTPASE, SULFATE ADENYLATE TRANSFERASE
           SUBUNIT 1; n=1; Wolinella succinogenes|Rep: GTPASE,
           SULFATE ADENYLATE TRANSFERASE SUBUNIT 1 - Wolinella
           succinogenes
          Length = 459

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 43/124 (34%), Positives = 62/124 (50%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           M      +NIV+ GHVD GKST  G L+   G + +  +E   +   +  + P       
Sbjct: 1   MSAHLERMNIVITGHVDHGKSTLVGRLLADTGSLPQGKLESVRESCAKNAR-PFEYSMLL 59

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
                    GITID A   F++      IIDAPGH +F++NM++G S+A  AVL++ A  
Sbjct: 60  DALEDEQKQGITIDSARIFFKSQAREYVIIDAPGHIEFLRNMLSGASRAVAAVLVIDAIE 119

Query: 472 GEFE 483
           G  E
Sbjct: 120 GVAE 123



 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 27/77 (35%), Positives = 46/77 (59%)
 Frame = +3

Query: 504 SNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFV 683
           +++ H LL   LG+ Q++V +NK+D+    Y +  F  I+ E  +Y+K +G  P   AFV
Sbjct: 124 NSKRHGLLLSLLGISQVVVVINKLDAL--GYDKNAFLAIQAEYEAYLKTLGITPK--AFV 179

Query: 684 PISGWHGDNMLEPSTKM 734
           PIS   G N+++ + +M
Sbjct: 180 PISAREGKNLIQKAPEM 196


>UniRef50_P02992 Cluster: Elongation factor Tu, mitochondrial
           precursor; n=1895; cellular organisms|Rep: Elongation
           factor Tu, mitochondrial precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 437

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 44/123 (35%), Positives = 65/123 (52%), Gaps = 3/123 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHL---IYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           + K H+NI  IGHVD GK+T T  +   +   GG +       +K  +E  +        
Sbjct: 44  RSKPHVNIGTIGHVDHGKTTLTAAITKTLAAKGGANFLDYAAIDKAPEERAR-------- 95

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI  A  ++ET+K + + +D PGH D+IKNMITG +Q D A+++VAA 
Sbjct: 96  ----------GITISTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAAT 145

Query: 469 TGE 477
            G+
Sbjct: 146 DGQ 148



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 17/51 (33%), Positives = 31/51 (60%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYN 662
           REH LLA  +GV+ ++V VNK+D+ + P      E ++ E+   + + G++
Sbjct: 153 REHLLLARQVGVQHIVVFVNKVDTIDDP---EMLELVEMEMRELLNEYGFD 200


>UniRef50_Q82L80 Cluster: Putative sulfate adenylyltransferase large
           subunit; n=1; Streptomyces avermitilis|Rep: Putative
           sulfate adenylyltransferase large subunit - Streptomyces
           avermitilis
          Length = 487

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 39/119 (32%), Positives = 59/119 (49%)
 Frame = +1

Query: 127 THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RL 306
           T +     G VD GKST  G L++    +    +E  E+ ++   +D  ++       R 
Sbjct: 20  TLLRFATAGSVDDGKSTLVGRLLHDSKSVLTDQLEAVEQVSRSRGQDAPDLALLTDGLRA 79

Query: 307 SVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
               GITID+A   F T++    + D PGH  + +NM+TG S AD AV++V A  G  E
Sbjct: 80  EREQGITIDVAYRYFATARRRFILADTPGHVQYTRNMVTGASTADLAVVLVDARNGVIE 138



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 28/75 (37%), Positives = 42/75 (56%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R HA +A  L V  +++ VNKMD  E  Y E  F  I ++ ++Y  ++G  P   A +PI
Sbjct: 141 RRHAAVAALLRVPHVVLAVNKMDLVE--YKESVFAAIAEKFTAYASELGV-PEITA-IPI 196

Query: 690 SGWHGDNMLEPSTKM 734
           S   GDN+++ S  M
Sbjct: 197 SALAGDNVVDASANM 211


>UniRef50_Q8WT68 Cluster: Elongation factor-1 alpha; n=3;
           Endopterygota|Rep: Elongation factor-1 alpha -
           Xiphocentron sp. UMSP000029372-Costa Rica
          Length = 366

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 35/73 (47%), Positives = 45/73 (61%)
 Frame = +2

Query: 515 ACLARFHPRCQTAHRRSKQNGFH*TTIQ*AQI*GNQEGSILIHQEDWLQPSCCRFRAHFW 694
           A LA  H R Q A RR +Q+G     +Q A + G+QEG +++HQED LQP     RAH  
Sbjct: 90  ARLAGLHARRQAARRRRQQDGLDGAALQRAALRGDQEGGVVVHQEDRLQPGRRGVRAHLG 149

Query: 695 MARRQHVGAFNQN 733
           +ARRQH GA  Q+
Sbjct: 150 LARRQHAGAVRQD 162



 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 29/62 (46%), Positives = 42/62 (67%)
 Frame = +3

Query: 318 RYHNRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLSG*LRCAHRSCRYR*IRSWYL* 497
           R+H+R+ ++EVR+ QVL  HH  +  Q  HQEHDH +++G LR A R  R+R +R  +L 
Sbjct: 24  RHHHRHRAVEVRDGQVLRDHHRRARPQGLHQEHDHGHVAGGLRRADRGRRHRRVRGGHLQ 83

Query: 498 ER 503
           ER
Sbjct: 84  ER 85


>UniRef50_Q0YG57 Cluster: Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit; n=2; Geobacter|Rep:
           Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit - Geobacter sp.
           FRC-32
          Length = 619

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 41/117 (35%), Positives = 59/117 (50%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           + +V +GHVD GKST  G +      +    +EK     ++  K       +        
Sbjct: 36  LQVVFVGHVDHGKSTLLGRIYADTDSLPVGQLEKVRAICEQQGKTFEYAFLFDAFLE-EQ 94

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
             GITID A   F     +  IIDAPGH++F+KNMI+G ++A+ AVLI+ A  G  E
Sbjct: 95  EQGITIDTARTFFNWGNRHYIIIDAPGHKEFLKNMISGAARAEAAVLIIDAAEGVAE 151



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 30/79 (37%), Positives = 45/79 (56%)
 Frame = +3

Query: 498 ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVA 677
           E+S R H  +   LG++Q+ V VNKMD     + +  FE I  E S+++K++G  P    
Sbjct: 151 EQSKR-HGYMLSLLGIRQIAVVVNKMDLVN--HDQKVFEAIVTEYSAFLKELGVTPR--Q 205

Query: 678 FVPISGWHGDNMLEPSTKM 734
           FVP S  +GDN++  S  M
Sbjct: 206 FVPASARNGDNVVTGSDAM 224


>UniRef50_Q0A978 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Alkalilimnicola ehrlichei MLHE-1|Rep:
           Sulfate adenylyltransferase, large subunit -
           Alkalilimnicola ehrlichei (strain MLHE-1)
          Length = 558

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 39/116 (33%), Positives = 55/116 (47%), Gaps = 2/116 (1%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEW--VKDPSNMLGYWTN*RL 306
           + ++  G VD GKST  G L+Y  G I    +   E+ +  +    D  ++         
Sbjct: 20  LRLLTCGSVDDGKSTLIGRLLYDAGAIPDDQLAAVERASARYGTTGDSPDLALLVDGLEA 79

Query: 307 SVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
               GITID+A   F T +    I D PGH  + +NM TG S AD A+L+V A  G
Sbjct: 80  EREQGITIDVAYRYFATERRKFIIADTPGHEQYTRNMATGASTADVAILLVDAAKG 135



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 20/69 (28%), Positives = 38/69 (55%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R H+ +   LG++ +++ VNKMD     + E  F  I+++      ++G     VA +P+
Sbjct: 141 RRHSAICALLGIRSVVLAVNKMDRV--AWDEATFRTIERDYRVLATRLGLE--QVACIPV 196

Query: 690 SGWHGDNML 716
           +  HGDN++
Sbjct: 197 AALHGDNVV 205


>UniRef50_Q96TK8 Cluster: Translation elongation factor 1 alpha;
           n=1; Phellopilus nigrolimitatus|Rep: Translation
           elongation factor 1 alpha - Phellopilus nigrolimitatus
          Length = 134

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 42/97 (43%), Positives = 50/97 (51%)
 Frame = +1

Query: 439 DCAVLIVAAGTGEFEAGISKNGQTVXXXXXXXXXXXXXXXXE*TKWIPLNHHTVSPDLRK 618
           DCA+LI+A GTGEFEAGISK+GQT                    K    N    +   R 
Sbjct: 1   DCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTTNGGPRAVSARL 60

Query: 619 SRRKYPHTSRRLATTQLLSLSCPFLDGTETTCWSLQP 729
           S +K+P +SRRL TT+ L  S  F  GT TTCW   P
Sbjct: 61  S-KKHPTSSRRLVTTRRLLPSFRFRAGTVTTCWKSLP 96


>UniRef50_A6GJE6 Cluster: Sulfate adenylyltransferase, large
           subunit; n=6; Bacteria|Rep: Sulfate adenylyltransferase,
           large subunit - Plesiocystis pacifica SIR-1
          Length = 653

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 40/119 (33%), Positives = 57/119 (47%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           + ++ +  V IG VD GKST  G L+Y+ GG+ +  +        E  +   N       
Sbjct: 47  ERRSLLRFVTIGSVDDGKSTLIGRLLYETGGVFEDQLAAVTSTDGEG-EASINFANLTDG 105

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                  GITID+A   F T K    I D PGH  + +NM TG S AD A++++ A  G
Sbjct: 106 LVAEREQGITIDVAYRYFATKKRKFIIADTPGHVQYTRNMATGASTADAAIILIDARLG 164



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 25/77 (32%), Positives = 46/77 (59%)
 Frame = +3

Query: 501 RSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAF 680
           + +R HA +A  +G+  L+V VNKMD  +  + +  ++ I  E  ++  K+G++   V F
Sbjct: 167 QQSRRHATIANLIGIPHLLVAVNKMDLVD--FDQGAYQAIVDEFRAFTAKLGFD--KVEF 222

Query: 681 VPISGWHGDNMLEPSTK 731
            P+S   GDN+++ ST+
Sbjct: 223 FPVSALEGDNVVQASTR 239


>UniRef50_A3HVR6 Cluster: Sulfate adenylyltransferase subunit 1;
           n=8; Bacteroidetes|Rep: Sulfate adenylyltransferase
           subunit 1 - Algoriphagus sp. PR1
          Length = 418

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 39/124 (31%), Positives = 59/124 (47%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           M + +  I I   G VD GKST  G L+Y    +    IE  E+ +++   D  +     
Sbjct: 1   MSENRKLIKIATAGSVDDGKSTLIGRLLYDTKSLTTDKIEAIERSSKQRGYDYLDFSLAT 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
                    GITID+A   F T K    + D PGH ++ +NM+TG S +  A++++ A  
Sbjct: 61  DGLVAEREQGITIDVAHIYFNTDKTNFIVADTPGHVEYTRNMVTGASTSQVAIILIDARK 120

Query: 472 GEFE 483
           G  E
Sbjct: 121 GVIE 124



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/73 (27%), Positives = 39/73 (53%)
 Frame = +3

Query: 516 HALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISG 695
           H  +A  L +  ++V +NKMD  +  Y E  + +IK +    ++K  ++   + F+P+S 
Sbjct: 129 HFFIANLLRISHVVVAINKMDLVD--YEEDVYLKIKADFDELVEKSDFSEDQITFIPVSA 186

Query: 696 WHGDNMLEPSTKM 734
             G+N+   S +M
Sbjct: 187 LKGENIARQSEEM 199


>UniRef50_Q2S507 Cluster: Sulfate adenylyltransferase, large subunit
           subfamily, putative; n=5; cellular organisms|Rep:
           Sulfate adenylyltransferase, large subunit subfamily,
           putative - Salinibacter ruber (strain DSM 13855)
          Length = 639

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 42/118 (35%), Positives = 57/118 (48%), Gaps = 1/118 (0%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*-RLS 309
           +     G VD GKST  G L+Y    I +  +E+ E+  Q    D    L   T+  R  
Sbjct: 14  LRFTTAGSVDDGKSTLIGRLMYDTQEIFEEKMEEIERNTQR--DDEELELALLTDGLRAE 71

Query: 310 VSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
              GITID+A   F T +    I D PGH  + +NM+TG S A+ AV ++ A  G  E
Sbjct: 72  REQGITIDVAYRYFSTPERKFIIADTPGHEQYTRNMVTGASTAELAVELIDARNGVLE 129



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 28/75 (37%), Positives = 36/75 (48%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R H  +   L +  +IV VNKMD     YSE RF EI  E   +   +      + FVPI
Sbjct: 132 RRHGFITSLLQIPHVIVAVNKMDLV--GYSEARFREIVAEYEDFADNLDVQD--ITFVPI 187

Query: 690 SGWHGDNMLEPSTKM 734
           S   GDN++  S  M
Sbjct: 188 SALKGDNVVHHSGNM 202


>UniRef50_Q19072 Cluster: Elongation factor Tu homologue precursor
           (Tu elongation factor (Ef- tu), mitochondrial protein
           1); n=7; Nematoda|Rep: Elongation factor Tu homologue
           precursor (Tu elongation factor (Ef- tu), mitochondrial
           protein 1) - Caenorhabditis elegans
          Length = 496

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 43/122 (35%), Positives = 63/122 (51%), Gaps = 3/122 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +        
Sbjct: 46  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKAR-------- 97

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+    ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA 
Sbjct: 98  ----------GITINAFHLEYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAAT 147

Query: 469 TG 474
            G
Sbjct: 148 DG 149


>UniRef50_Q0G239 Cluster: Binfunctional sulfate adenylyltransferase
           subunit 1/adenylylsulfate kinase protein; n=2;
           Aurantimonadaceae|Rep: Binfunctional sulfate
           adenylyltransferase subunit 1/adenylylsulfate kinase
           protein - Fulvimarina pelagi HTCC2506
          Length = 578

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 39/116 (33%), Positives = 59/116 (50%), Gaps = 2/116 (1%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +  +  G VD GKST  G L+Y+   +    +E  EK+++++     ++        LS 
Sbjct: 59  LRFITCGSVDDGKSTLIGRLLYETNAVFDDQMEALEKDSKKFGTTGGDLDFALLVDGLSA 118

Query: 313 S--VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
               GITID+A   F +      I D PGH  + +NM TG SQA+ AV++V A  G
Sbjct: 119 EREQGITIDVAYRYFSSENRAFIIADTPGHEQYTRNMATGASQAELAVILVDARKG 174



 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 22/72 (30%), Positives = 48/72 (66%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R H+ +   +G+K +++ +NKMD  +  ++E RF+ IK++  + + ++G+    V++VP+
Sbjct: 180 RRHSFITSLVGIKSVVIAINKMDLVD--FAEERFDAIKRDYEAILPQLGFTD--VSYVPL 235

Query: 690 SGWHGDNMLEPS 725
           S  +GDN+++ S
Sbjct: 236 SAKNGDNIVKRS 247


>UniRef50_A4SYY3 Cluster: Sulfate adenylyltransferase, large
           subunit; n=13; Proteobacteria|Rep: Sulfate
           adenylyltransferase, large subunit - Polynucleobacter
           sp. QLW-P1DMWA-1
          Length = 447

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 41/114 (35%), Positives = 56/114 (49%), Gaps = 3/114 (2%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK--EAQEWVKDPSNMLGYWTN*-R 303
           +  +  G VD GKST  G L+Y    I    +E   K   A+    D    L   T+   
Sbjct: 10  VRFITAGSVDDGKSTLIGRLLYDTKSILVDQLESLSKTKHARVTSSDAGVDLALLTDGLE 69

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                GITID+A   F T K    + DAPGH  + +N++TG SQ+D AV++V A
Sbjct: 70  AEREQGITIDVAYRYFSTPKRKFIVADAPGHEQYTRNLVTGASQSDVAVILVDA 123



 Score = 36.3 bits (80), Expect = 0.78
 Identities = 20/72 (27%), Positives = 36/72 (50%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           + HA +   LG++ ++  +NKMD  +  + E  +  IK  +    +KIG     +  +PI
Sbjct: 140 KRHAAIVHLLGLRHVVFAINKMDLFD--FDEKVYNTIKASIEDLTQKIGLPKRTL--IPI 195

Query: 690 SGWHGDNMLEPS 725
           S   G N++  S
Sbjct: 196 SALLGANVVTAS 207


>UniRef50_A0EFI6 Cluster: Elongation factor Tu; n=3; Paramecium
           tetraurelia|Rep: Elongation factor Tu - Paramecium
           tetraurelia
          Length = 471

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 43/122 (35%), Positives = 68/122 (55%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           K  ++K H+N+  IGH+D GK+T T   I K   + K+ + +F+ E  +  K P      
Sbjct: 24  KFVRDKPHLNVGTIGHIDHGKTTLTS-AITKV--LAKQQLAEFQ-EYGKIDKAPEEK--- 76

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                   + GITI+ A  +++T   +   +D PGH D++KNMITG ++ D A+L+VAA 
Sbjct: 77  --------ARGITINSATVEYQTKTRHYGHVDCPGHIDYVKNMITGAAKMDAAILVVAAT 128

Query: 469 TG 474
            G
Sbjct: 129 DG 130



 Score = 34.3 bits (75), Expect = 3.1
 Identities = 23/71 (32%), Positives = 33/71 (46%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REH LL   +GV+ +IV VNK+D  + P      E ++ E+   + K  Y+      V  
Sbjct: 136 REHVLLCRQVGVETIIVFVNKIDLAKDPEIH---ELVEMEIRELLSKYEYDGDNAKIVKG 192

Query: 690 SGWHGDNMLEP 722
           S     N  EP
Sbjct: 193 SALLASNDQEP 203


>UniRef50_UPI00006CBD5B Cluster: Elongation factor Tu, mitochondrial
           precursor, putative; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu, mitochondrial
           precursor, putative - Tetrahymena thermophila SB210
          Length = 375

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 40/122 (32%), Positives = 63/122 (51%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           K  + K H+N+  IGH+D GK+T T  +   C   DK+  E    ++ +  K P      
Sbjct: 26  KFQRNKPHLNVGTIGHIDHGKTTLTAAITKICA--DKKLAEFMAYDSID--KAPEEK--- 78

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                   + GITI+ A  ++ET   +   +D PGH D++KNMITG ++ D  +L+ +A 
Sbjct: 79  --------ARGITINTATVEYETETRHYGHVDCPGHIDYVKNMITGAAKMDAGILVCSAT 130

Query: 469 TG 474
            G
Sbjct: 131 DG 132



 Score = 36.7 bits (81), Expect = 0.59
 Identities = 21/51 (41%), Positives = 28/51 (54%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYN 662
           REH LL   +GVK +IV VNK D  + P  +   E ++ EV   + K  YN
Sbjct: 138 REHILLCRQVGVKTIIVFVNKCDMAKDPEIQ---ELVEMEVRELLSKYEYN 185


>UniRef50_UPI000050FE96 Cluster: COG2895: GTPases - Sulfate
           adenylate transferase subunit 1; n=1; Brevibacterium
           linens BL2|Rep: COG2895: GTPases - Sulfate adenylate
           transferase subunit 1 - Brevibacterium linens BL2
          Length = 448

 Score = 67.3 bits (157), Expect = 4e-10
 Identities = 40/122 (32%), Positives = 58/122 (47%), Gaps = 2/122 (1%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE--WVKDPSNMLGYWTN 297
           KT +     G VD GKST  G L++    I    +E   + ++E  +V    +       
Sbjct: 14  KTLLRFATAGSVDDGKSTLVGRLLHDAKAILADQLEAVTRTSEERGFVGGEFDFALLTDG 73

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
            R     GITID+A   F T K    + D PGH  + +NM+TG + AD  V+++ A TG 
Sbjct: 74  LRAEREQGITIDVAYRYFATDKRSFILADCPGHVQYTRNMVTGATTADAVVVLIDARTGA 133

Query: 478 FE 483
            E
Sbjct: 134 TE 135



 Score = 42.7 bits (96), Expect = 0.009
 Identities = 20/72 (27%), Positives = 41/72 (56%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R H  +   LG++ +I+ +NK+D  +  Y +  + +++ E+ +   +IG + A +  +P+
Sbjct: 138 RRHLTVVHRLGIRHVILAINKIDLLD--YDQAAYAKVEAEIEALTAEIGLDSAHL--IPV 193

Query: 690 SGWHGDNMLEPS 725
           S   GDN+ E S
Sbjct: 194 SALAGDNVAEAS 205


>UniRef50_P49411 Cluster: Elongation factor Tu, mitochondrial
           precursor; n=73; cellular organisms|Rep: Elongation
           factor Tu, mitochondrial precursor - Homo sapiens
           (Human)
          Length = 452

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 40/122 (32%), Positives = 63/122 (51%), Gaps = 3/122 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +        
Sbjct: 53  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERAR-------- 104

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA 
Sbjct: 105 ----------GITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAAN 154

Query: 469 TG 474
            G
Sbjct: 155 DG 156



 Score = 33.5 bits (73), Expect = 5.5
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGY 659
           REH LLA  +GV+ ++V VNK D+ +        E ++ E+   + + GY
Sbjct: 162 REHLLLARQIGVEHVVVYVNKADAVQ---DSEMVELVELEIRELLTEFGY 208


>UniRef50_Q7UMW2 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=24; Bacteria|Rep:
           Bifunctional enzyme cysN/cysC [Includes: Sulfate
           adenylyltransferase subunit 1 (EC 2.7.7.4) (Sulfate
           adenylate transferase) (SAT) (ATP- sulfurylase large
           subunit); Adenylyl-sulfate kinase (EC 2.7.1.25) (APS
           kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)] - Rhodopirellula baltica
          Length = 647

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 2/124 (1%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA--QEWVKDPSNML 282
           K  ++K  +  +  G VD GKST  G L+Y    + +  + K + ++  Q  V    +  
Sbjct: 17  KQHEQKQLLRFITCGSVDDGKSTLIGRLLYDSKLVYEDELAKVQSDSVRQGSVAGGFDPS 76

Query: 283 GYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
            +    +     GITID+A   F T+K    I D PGH  + +NM TG S AD A++++ 
Sbjct: 77  LFMDGLKEEREQGITIDVAYRYFSTAKRKFIIADTPGHEQYTRNMATGASSADLAIILID 136

Query: 463 AGTG 474
           A  G
Sbjct: 137 ARHG 140



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 27/75 (36%), Positives = 44/75 (58%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R H+ +   LG++ ++V VNKMD     YSE RF EI  +  S+  ++  +   + F+PI
Sbjct: 146 RRHSFIVSLLGIRHVVVAVNKMDIDGVDYSEDRFNEICDDYRSFATRL--DLPDLHFIPI 203

Query: 690 SGWHGDNMLEPSTKM 734
           S  +GDN+++ S  M
Sbjct: 204 SALNGDNLVDRSENM 218


>UniRef50_Q0EDG4 Cluster: Mitochondrial EF-Tu2; n=1; Trichinella
           britovi|Rep: Mitochondrial EF-Tu2 - Trichinella britovi
          Length = 428

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 47/117 (40%), Positives = 57/117 (48%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K + NI  IGH+D GK+T T  L      + K T  KF     E  K P           
Sbjct: 26  KENFNIGTIGHIDHGKTTLTAALTKV---LSKTTNTKFVP-FDEIDKAPEEQ-------- 73

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                GITI IA   +ET K   +  D PGH+DFIKNMI G +Q D A+L+V A  G
Sbjct: 74  ---QRGITISIAHVGYETKKRKYSHTDCPGHKDFIKNMICGATQMDAAILVVDAAEG 127


>UniRef50_Q8AAP9 Cluster: Sulfate adenylyltransferase subunit 1;
           n=17; Bacteria|Rep: Sulfate adenylyltransferase subunit
           1 - Bacteroides thetaiotaomicron
          Length = 485

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 38/122 (31%), Positives = 64/122 (52%), Gaps = 3/122 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY--- 288
           ++K  + ++  G VD GKST  G L++    + +  ++  E++++  V +    + Y   
Sbjct: 15  EQKDLLRLLTAGSVDDGKSTLIGRLLFDSKKLYEDQLDALERDSKR-VGNAGEHIDYALL 73

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
               +     GITID+A   F T+     I D PGH  + +NMITG S A+ A+++V A 
Sbjct: 74  LDGLKAEREQGITIDVAYRYFSTNGRKFIIADTPGHEQYTRNMITGGSTANLAIILVDAR 133

Query: 469 TG 474
           TG
Sbjct: 134 TG 135



 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 26/74 (35%), Positives = 43/74 (58%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R H  L   LG+K +++ VNKMD  +  +SE RF+EI  E   +++ +G     V  +P+
Sbjct: 141 RRHTFLVSLLGIKHVVLAVNKMDLVD--FSEERFDEIVSEYKKFVEPLGI--PDVNCIPL 196

Query: 690 SGWHGDNMLEPSTK 731
           S   GDN+++ S +
Sbjct: 197 SALDGDNVVDKSER 210


>UniRef50_Q10600 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=24; Bacteria|Rep:
           Bifunctional enzyme cysN/cysC [Includes: Sulfate
           adenylyltransferase subunit 1 (EC 2.7.7.4) (Sulfate
           adenylate transferase) (SAT) (ATP- sulfurylase large
           subunit); Adenylyl-sulfate kinase (EC 2.7.1.25) (APS
           kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)] - Mycobacterium tuberculosis
          Length = 614

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 38/119 (31%), Positives = 57/119 (47%)
 Frame = +1

Query: 127 THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RL 306
           T + +   G VD GKST  G L+Y    + +      E+ +++   D +++       R 
Sbjct: 3   TLLRLATAGSVDDGKSTLIGRLLYDSKAVMEDQWASVEQTSKDRGHDYTDLALVTDGLRA 62

Query: 307 SVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
               GITID+A   F T K    I D PGH  + +NM+TG S A   +++V A  G  E
Sbjct: 63  EREQGITIDVAYRYFATPKRKFIIADTPGHIQYTRNMVTGASTAQLVIVLVDARHGLLE 121



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 25/73 (34%), Positives = 42/73 (57%)
 Frame = +3

Query: 507 NREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVP 686
           +R HA LA  LG++ L++ VNKMD     + + +F+ I+ E  ++  ++      V  +P
Sbjct: 123 SRRHAFLASLLGIRHLVLAVNKMDLL--GWDQEKFDAIRDEFHAFAARLDVQD--VTSIP 178

Query: 687 ISGWHGDNMLEPS 725
           IS  HGDN++  S
Sbjct: 179 ISALHGDNVVTKS 191


>UniRef50_Q9PD78 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=138; root|Rep: Bifunctional
           enzyme cysN/cysC [Includes: Sulfate adenylyltransferase
           subunit 1 (EC 2.7.7.4) (Sulfate adenylate transferase)
           (SAT) (ATP- sulfurylase large subunit); Adenylyl-sulfate
           kinase (EC 2.7.1.25) (APS kinase) (ATP
           adenosine-5'-phosphosulfate 3'-phosphotransferase)] -
           Xylella fastidiosa
          Length = 623

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 40/124 (32%), Positives = 60/124 (48%), Gaps = 2/124 (1%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           K  + K  +  +  G VD GKST  GHL+Y    + +  +     ++Q +     ++   
Sbjct: 9   KQQEIKPLLRFITCGSVDDGKSTLIGHLLYDSQCLAEDQLADLMVDSQRYGTQGEHIDYA 68

Query: 289 WTN*RLSVS--VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
                L+     GITID+A   F+T K    + D PGH  + +NM TG S AD AV++V 
Sbjct: 69  LLLDGLAAEREQGITIDVAYRYFDTEKRKFIVADCPGHAQYTRNMATGASTADAAVVLVD 128

Query: 463 AGTG 474
           A  G
Sbjct: 129 ARKG 132



 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 24/75 (32%), Positives = 40/75 (53%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R H+ +   LG++ +++ VNKMD     Y +  FE I  +  +   K+G N   V  +P+
Sbjct: 138 RRHSYIVALLGIRHVVLAVNKMDLV--GYDQETFEAIASDYLALAAKLGIN--QVQCIPL 193

Query: 690 SGWHGDNMLEPSTKM 734
           S   GDN+ + S +M
Sbjct: 194 SALEGDNLSKRSARM 208


>UniRef50_Q39DS0 Cluster: Sulfate adenylyltransferase, large
           subunit; n=29; Burkholderiaceae|Rep: Sulfate
           adenylyltransferase, large subunit - Burkholderia sp.
           (strain 383) (Burkholderia cepacia (strain ATCC 17760/
           NCIB 9086 / R18194))
          Length = 438

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 36/122 (29%), Positives = 57/122 (46%), Gaps = 1/122 (0%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK-EAQEWVKDPSNMLGYWTN*RLS 309
           +  +  G VD GKST  G L+Y    +    +    + + +  V D  ++          
Sbjct: 13  LRFITAGSVDDGKSTLIGRLLYDSKAVLSDQLSALSRAKNKRTVGDELDLALLTDGLEAE 72

Query: 310 VSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 489
              GITID+A   F T+K    I D PGH  + +NM+TG S A  A++++ A     E G
Sbjct: 73  REQGITIDVAYRYFATAKRKFIIADTPGHEQYTRNMVTGASTAHAAIILIDATRVTIENG 132

Query: 490 IS 495
           ++
Sbjct: 133 VA 134



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 27/75 (36%), Positives = 43/75 (57%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           + H+ +   L ++ +IV +NKMD  +  YSE RF EI+    +  K++G     V FVP+
Sbjct: 141 KRHSAIVKLLALQHVIVAINKMDLVD--YSEARFNEIRDAYVTLAKQLGLTD--VRFVPV 196

Query: 690 SGWHGDNMLEPSTKM 734
           S   GDN++  S +M
Sbjct: 197 SALKGDNIVGASERM 211


>UniRef50_Q22GX7 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 432

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 27/72 (37%), Positives = 50/72 (69%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           ++  +LA +LGVKQ+IV +NK++     +SE  F  +K ++ +Y+ +I +NP ++ ++P+
Sbjct: 133 KQQLILAQSLGVKQIIVALNKIEIVN--FSENEFTLMKNQIDNYLHEIKFNPESIFYIPV 190

Query: 690 SGWHGDNMLEPS 725
           SG  GDN++E S
Sbjct: 191 SGVKGDNLVEKS 202



 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 39/118 (33%), Positives = 63/118 (53%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           M K+K  INI+V+G  +SG+STT GH +YK      + ++ F   +Q   +   +     
Sbjct: 1   MFKKKEIINIIVLGSTNSGRSTTVGHFLYKLSKECPQLLQYFNTTSQITEEKDIDFTIPL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
            N +  +      +     FE + +   I+D  GH++F+KN+I+G S+A   VLIVAA
Sbjct: 61  KNLQFELERNSEQEEKHICFEMNNHNYEIVDIIGHKNFVKNIISGQSKAH-VVLIVAA 117


>UniRef50_P56893 Cluster: Sulfate adenylyltransferase subunit 1;
           n=7; Rhizobiaceae|Rep: Sulfate adenylyltransferase
           subunit 1 - Rhizobium meliloti (Sinorhizobium meliloti)
          Length = 498

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 39/120 (32%), Positives = 56/120 (46%), Gaps = 3/120 (2%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKD---PSNMLGYWTN*R 303
           + ++  G VD GKST  G L++    + +      ++++     D   P   L      +
Sbjct: 33  LRLITCGSVDDGKSTLIGRLLWDTKAVKEDQAASLQRDSSGKQNDLGLPDFAL-LLDGLQ 91

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                GITID+A   F T K    + D PGH  + +NM TG S AD AVL+V A  G  E
Sbjct: 92  AEREQGITIDVAYRYFATDKRSFIVADTPGHEQYTRNMATGASTADLAVLLVDARVGLLE 151



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R HA +A  +G++Q ++ VNK+D T   Y   RF++I  E       +G     V  +P+
Sbjct: 154 RRHATIATLMGIRQFVLAVNKIDLTN--YDRARFDQISHEFRELALSLGVR--QVTAIPV 209

Query: 690 SGWHGDNML 716
           S   G+N++
Sbjct: 210 SALKGENVV 218


>UniRef50_Q9UVK1 Cluster: SUP35 homolog; n=1; Pichia pastoris|Rep:
           SUP35 homolog - Pichia pastoris (Yeast)
          Length = 315

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 26/44 (59%), Positives = 37/44 (84%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE 255
           K HI+I+ +GHVD+GKST  G+L+Y  G +DKRTI+K+EKEA++
Sbjct: 238 KDHISILFMGHVDAGKSTMGGNLLYLTGSVDKRTIDKYEKEAKD 281


>UniRef50_Q5BEE6 Cluster: Elongation factor Tu; n=1; Emericella
           nidulans|Rep: Elongation factor Tu - Emericella nidulans
           (Aspergillus nidulans)
          Length = 461

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 43/120 (35%), Positives = 58/120 (48%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           + K H+NI  IGHVD GK+T T  +        K   +  E  A +  K P         
Sbjct: 48  RTKPHVNIGTIGHVDHGKTTLTAAITKHQAS--KGLAQFLEYGAID--KAPEER------ 97

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
                  GITI  A  +F T   +   +D PGH D+IKNMITG +  D A+++VAA  G+
Sbjct: 98  -----KRGITISTAHIEFSTDNRHYAHVDCPGHADYIKNMITGAANMDGAIVVVAASDGQ 152



 Score = 34.3 bits (75), Expect = 3.1
 Identities = 14/28 (50%), Positives = 22/28 (78%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPP 593
           REH LLA  +GV++++V VNK+D+ + P
Sbjct: 157 REHLLLARQVGVQKIVVFVNKVDAVDDP 184


>UniRef50_Q9RGE9 Cluster: Sulfate adenylyltransferase subunit CysN;
           n=7; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit CysN - Campylobacter jejuni
          Length = 472

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 37/121 (30%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEW--VKDPSNMLGYW 291
           + K     +  G VD GKST  G L+Y    +    +   EK++++     D  +     
Sbjct: 13  ENKELCRFITCGSVDDGKSTLIGRLLYDTKALFSDQLSTLEKDSKKMGNAGDKLDFALLV 72

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
                    GITID+A   F ++K    I D PGH  + +NM TG S AD A++++ A  
Sbjct: 73  DGLASEREQGITIDVAYRFFTSNKRKFIIADTPGHEQYTRNMATGASTADIAIILIDARK 132

Query: 472 G 474
           G
Sbjct: 133 G 133



 Score = 40.3 bits (90), Expect = 0.048
 Identities = 21/78 (26%), Positives = 36/78 (46%)
 Frame = +3

Query: 501 RSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAF 680
           +  + H+ +   LG+K  I+ +NKMD     Y E  F  I K+    I  +        F
Sbjct: 136 KQTKRHSYIVSLLGIKNFIIAINKMDLVS--YEEKIFNNICKDYEKIIPYL-QEDIQTHF 192

Query: 681 VPISGWHGDNMLEPSTKM 734
           +PI   +G+N+ + S  +
Sbjct: 193 IPICALNGENITQKSRNL 210


>UniRef50_Q1ITG6 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Acidobacteria bacterium Ellin345|Rep:
           Sulfate adenylyltransferase, large subunit -
           Acidobacteria bacterium (strain Ellin345)
          Length = 543

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 36/117 (30%), Positives = 52/117 (44%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  + I   G VD GKST  G L+Y    + +  +    +          +        R
Sbjct: 26  KDILRISTAGSVDDGKSTLIGRLLYDSRNVYEDHVRSVTRHDVSLGTSVVDFAQLTDGLR 85

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                GITID+A   F T+K    I D PGH  + +NM TG S +D A++++ A  G
Sbjct: 86  AEREQGITIDVAYRYFSTAKRKFIIADTPGHEQYTRNMATGASTSDLAIVLIDARKG 142



 Score = 36.7 bits (81), Expect = 0.59
 Identities = 23/75 (30%), Positives = 39/75 (52%)
 Frame = +3

Query: 507 NREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVP 686
           +R H  +A  LG+ +++  +NKMD  +  +S   F     E+      +G  P+ V  +P
Sbjct: 147 SRRHLYIAALLGIPRVVATINKMDLVD--FSPEVFAAHSLELKRLGDGLGI-PSLVT-IP 202

Query: 687 ISGWHGDNMLEPSTK 731
           IS   GDN++E S +
Sbjct: 203 ISALDGDNVVETSAR 217


>UniRef50_A4VDD2 Cluster: Elongation factor 1-alpha; n=1;
           Tetrahymena thermophila SB210|Rep: Elongation factor
           1-alpha - Tetrahymena thermophila SB210
          Length = 356

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 30/79 (37%), Positives = 47/79 (59%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K H+++ V G VDSGKSTT GHL++K G +++R I++ +  A++  K            +
Sbjct: 4   KQHLSVAVFGDVDSGKSTTCGHLVFKLGEVNQRKIDELKALAEKEGKSSFGFAYVMDRTK 63

Query: 304 LSVSVGITIDIALWKFETS 360
              S GITID+ + KF T+
Sbjct: 64  AERSRGITIDVTMLKFNTN 82



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 25/46 (54%), Positives = 33/46 (71%)
 Frame = +3

Query: 597 SEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKM 734
           +E RFE IK EVS Y++KIG+N   V+F+PISG+ G N+ E S  M
Sbjct: 83  NEERFENIKSEVSLYLQKIGFNLKNVSFIPISGYIGHNLTEKSESM 128


>UniRef50_O83217 Cluster: Elongation factor Tu; n=7; cellular
           organisms|Rep: Elongation factor Tu - Treponema pallidum
          Length = 395

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 39/122 (31%), Positives = 63/122 (51%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           K  + K H+N+  IGHVD GK+T +  +   C    K+  +K + +  E    P      
Sbjct: 5   KFARTKVHMNVGTIGHVDHGKTTLSAAITSYCA---KKFGDK-QLKYDEIDNAPEEK--- 57

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                   + GITI+    ++++ + +   ID PGH D++KNMITG +Q D  +L+V+A 
Sbjct: 58  --------ARGITINTRHLEYQSDRRHYAHIDCPGHADYVKNMITGAAQMDGGILVVSAP 109

Query: 469 TG 474
            G
Sbjct: 110 DG 111


>UniRef50_P91150 Cluster: Tu elongation factor (Ef-tu),
           mitochondrial protein 2; n=5; Chromadorea|Rep: Tu
           elongation factor (Ef-tu), mitochondrial protein 2 -
           Caenorhabditis elegans
          Length = 439

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 44/120 (36%), Positives = 61/120 (50%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K ++N+  IGH+D GK+T T  +          T  + +K   + +K      G     R
Sbjct: 43  KINVNVGTIGHIDHGKTTLTSAI----------TRVQAKKGFAKHIKFDEIDKGKEEKKR 92

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
                GITI++A   +E+     +  D PGH DFIKNMI GTSQ D AVL++AA  G  E
Sbjct: 93  -----GITINVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME 147


>UniRef50_A6GM01 Cluster: Bifunctional sulfate adenylyltransferase
           subunit 1/adenylylsulfate kinase protein; n=1;
           Limnobacter sp. MED105|Rep: Bifunctional sulfate
           adenylyltransferase subunit 1/adenylylsulfate kinase
           protein - Limnobacter sp. MED105
          Length = 575

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 35/116 (30%), Positives = 56/116 (48%), Gaps = 2/116 (1%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +  +  G VD GKST  G ++++   + +  +     E++ +     N+        LS 
Sbjct: 20  LRFITCGSVDDGKSTLIGRMLWESQQLFEDQVAALRNESKRYGTQGDNIDYALLVDGLSA 79

Query: 313 S--VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
               GITID+A   F+T      + D PGH  + +NM+TG S A  AVL++ A  G
Sbjct: 80  EREQGITIDVAYRYFQTDARKFIVADTPGHEQYTRNMVTGASTAHLAVLLIDARKG 135



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/72 (31%), Positives = 39/72 (54%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R HA L   +G++ L++ VNKMD  +  + +  ++ I  + + Y K +     AV  +P+
Sbjct: 141 RRHAFLTQLVGIRHLVLAVNKMDLVD--FKQEVYDRIVADFAGYAKALSIE--AVQAIPL 196

Query: 690 SGWHGDNMLEPS 725
           S   GDN+ E S
Sbjct: 197 SAIGGDNLRERS 208


>UniRef50_Q9UVK0 Cluster: SUP35 homolog; n=1; Saccharomycodes
           ludwigii|Rep: SUP35 homolog - Saccharomycodes ludwigii
          Length = 305

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 24/44 (54%), Positives = 37/44 (84%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE 255
           K H++++ +GHVD+GKST  G+L+Y  G +DKRTIEK+E+EA++
Sbjct: 256 KDHMSLLFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKD 299


>UniRef50_Q9L9U8 Cluster: Putative ATP sulfurylase large subunit;
           n=2; Proteobacteria|Rep: Putative ATP sulfurylase large
           subunit - Chromatium vinosum (Allochromatium vinosum)
          Length = 434

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 36/114 (31%), Positives = 51/114 (44%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +  +  G VD GKST  G L+Y    I   T+      +Q       ++       +   
Sbjct: 15  LRFLTCGSVDDGKSTLIGRLLYDTKAILADTLHAIAATSQRRGLSELDLSLLTDGLQAER 74

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             GITID+A   F T      I DAPGH  + +NM+T  S A  A+++V A  G
Sbjct: 75  EQGITIDVAYRYFSTGTRKYIIADAPGHEQYTRNMVTAASTAHLAIILVDARRG 128



 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 27/79 (34%), Positives = 44/79 (55%)
 Frame = +3

Query: 498 ERSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVA 677
           +   R H+ LA  +G+  L+V VNKMD  +  Y +  FE I+ E   +  ++G     V 
Sbjct: 130 QTQTRRHSYLAHLVGLPHLVVAVNKMDLVD--YDQAVFERIRAEYLDFAARLGIED--VR 185

Query: 678 FVPISGWHGDNMLEPSTKM 734
           F+P+S  HGDN++E   ++
Sbjct: 186 FIPLSALHGDNVVERGERL 204


>UniRef50_Q25820 Cluster: Elongation factor Tu; n=99; cellular
           organisms|Rep: Elongation factor Tu - Plasmodium
           falciparum
          Length = 410

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 39/118 (33%), Positives = 59/118 (50%), Gaps = 3/118 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCG--GIDKR-TIEKFEKEAQEWVKDPSNMLGY 288
           + K HIN+  IGHVD GK+T T  + Y     G+ K+      +   +E ++        
Sbjct: 8   RNKQHINLGTIGHVDHGKTTLTTAISYLLNLQGLSKKYNYSDIDSAPEEKIR-------- 59

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 462
                     GITI+    ++ET   +   ID PGH D+IKNMI G +Q D A+L+++
Sbjct: 60  ----------GITINTTHIEYETLTKHCAHIDCPGHSDYIKNMIIGATQMDIAILVIS 107


>UniRef50_Q0SH95 Cluster: CysN/CysC bifunctional enzyme; n=14;
           Actinomycetales|Rep: CysN/CysC bifunctional enzyme -
           Rhodococcus sp. (strain RHA1)
          Length = 627

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 37/114 (32%), Positives = 51/114 (44%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           + +   G VD GKST  G L++  G +    +E       E     +++       R   
Sbjct: 11  LRLATAGSVDDGKSTLIGRLLHDTGSLPTDHLEAVTNADGE-----ADLAALSDGLRAER 65

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             GITID+A   F T      + D PGH  + +NM TG S A  AVL+V A  G
Sbjct: 66  EQGITIDVAYRFFSTPTRSFVLADTPGHERYTRNMFTGASNAHVAVLLVDARAG 119



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/75 (34%), Positives = 42/75 (56%)
 Frame = +3

Query: 501 RSNREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAF 680
           R  R HA +A  LGV  L+  VNK+D  +  + E RF+E++ E+    +++G     V  
Sbjct: 122 RQTRRHARIADLLGVPHLVAVVNKIDLVD--FDETRFKEVESELGLLAQRLGGRDLTV-- 177

Query: 681 VPISGWHGDNMLEPS 725
           +P+S   GDN++  S
Sbjct: 178 IPVSATRGDNVVTRS 192


>UniRef50_Q8ZBP2 Cluster: Sulfate adenylyltransferase subunit 1;
           n=20; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit 1 - Yersinia pestis
          Length = 478

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 37/121 (30%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNM-LGYWT 294
           + KT +  +  G VD GKST  G L++    I +  +     +++        + L    
Sbjct: 26  QHKTMLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSTLHTDSKRIGTQGEKLDLALLV 85

Query: 295 N*-RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
           +  +     GITID+A   F T K    I D PGH  + +NM TG S  D A+L++ A  
Sbjct: 86  DGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARK 145

Query: 472 G 474
           G
Sbjct: 146 G 146



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 27/75 (36%), Positives = 42/75 (56%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R H+ +A  LG++ L+V VNKMD     + E  F + K +  S+ +++      + FVP+
Sbjct: 152 RRHSFIATLLGIRHLVVAVNKMDLV--GFQESVFTQFKDDYLSFAEQLP-TDLDIKFVPL 208

Query: 690 SGWHGDNMLEPSTKM 734
           S   GDN+  PS KM
Sbjct: 209 SALDGDNVASPSEKM 223


>UniRef50_Q4G4A5 Cluster: Elongation factor 1A; n=86; Eukaryota|Rep:
           Elongation factor 1A - Echinostelium minutum
          Length = 237

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 24/30 (80%), Positives = 26/30 (86%)
 Frame = +3

Query: 645 KKIGYNPAAVAFVPISGWHGDNMLEPSTKM 734
           KKIGYNP  +AFVPISGWHGDNMLE ST +
Sbjct: 1   KKIGYNPEKIAFVPISGWHGDNMLEKSTNL 30


>UniRef50_Q8TYZ3 Cluster: GTPase-translation elongation factor; n=1;
           Methanopyrus kandleri|Rep: GTPase-translation elongation
           factor - Methanopyrus kandleri
          Length = 459

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 25/52 (48%), Positives = 33/52 (63%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GITID+    FE   Y VT++DAPGH D I+ ++ G    D A+L+VAA  G
Sbjct: 42  GITIDLGFSSFELGDYTVTLVDAPGHADLIRTVVAGAEIIDAAILVVAADEG 93


>UniRef50_A2WJZ4 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 806

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 27/70 (38%), Positives = 46/70 (65%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EHA L  + GV+QLIV VNKMD+    YS+ RFE IK ++ S+++   +  ++V ++P+
Sbjct: 505 KEHAQLIRSFGVEQLIVAVNKMDAIG--YSKERFEFIKVQLGSFLRACNFKDSSVTWIPL 562

Query: 690 SGWHGDNMLE 719
           S     N+++
Sbjct: 563 SAVENQNLIK 572



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 21/43 (48%), Positives = 32/43 (74%)
 Frame = +1

Query: 127 THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE 255
           + +N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E
Sbjct: 427 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKE 469



 Score = 33.9 bits (74), Expect = 4.2
 Identities = 13/20 (65%), Positives = 15/20 (75%)
 Frame = +3

Query: 258 GKGSFKYAWVLDKLKAERER 317
           GKGSF YAW +D+   ERER
Sbjct: 471 GKGSFAYAWAMDESSEERER 490


>UniRef50_Q83JX8 Cluster: Sulfate adenylyltransferase subunit 1;
           n=26; Bacteria|Rep: Sulfate adenylyltransferase subunit
           1 - Shigella flexneri
          Length = 475

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNM-LGYWT 294
           + K+ +  +  G VD GKST  G L++    I +  +     +++        + L    
Sbjct: 23  QHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLV 82

Query: 295 N*-RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
           +  +     GITID+A   F T K    I D PGH  + +NM TG S  + A+L++ A  
Sbjct: 83  DGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCELAILLIDARK 142

Query: 472 G 474
           G
Sbjct: 143 G 143



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 26/75 (34%), Positives = 43/75 (57%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R H+ ++  LG+K L+V +NKMD  +  YSE  F  I+++  ++  ++  N   + FVP+
Sbjct: 149 RRHSFISTLLGIKHLVVAINKMDLVD--YSEETFTRIREDYLTFAGQLPGN-LDIRFVPL 205

Query: 690 SGWHGDNMLEPSTKM 734
           S   GDN+   S  M
Sbjct: 206 SALEGDNVASQSESM 220


>UniRef50_Q8ZMF5 Cluster: Sulfate adenylyltransferase subunit 1;
           n=38; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit 1 - Salmonella typhimurium
          Length = 479

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNM-LGYWT 294
           + K+ +  +  G VD GKST  G L++    I +  +     +++        + L    
Sbjct: 23  QHKSLLRFLTCGSVDDGKSTLIGRLLHDTLQIYEDQLSSLHNDSKRHGTQGEKLDLALLV 82

Query: 295 N*-RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
           +  +     GITID+A   F T +    I D PGH  + +NM TG S  D A+L++ A  
Sbjct: 83  DGLQAEREQGITIDVAYRYFSTERRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARK 142

Query: 472 G 474
           G
Sbjct: 143 G 143



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R H+ ++  LG+K L+V +NKMD  +  Y E  F  I+++  ++ +++      + FVP+
Sbjct: 149 RRHSFISTLLGIKHLVVAINKMDLVD--YREETFARIREDYLTFAEQLP-GDLDIRFVPL 205

Query: 690 SGWHGDNMLEPSTKM 734
           S   GDN+   S  M
Sbjct: 206 SALEGDNVAAQSANM 220


>UniRef50_Q8NLX2 Cluster: GTPases-Sulfate adenylate transferase
           subunit 1; n=5; Actinomycetales|Rep: GTPases-Sulfate
           adenylate transferase subunit 1 - Corynebacterium
           glutamicum (Brevibacterium flavum)
          Length = 433

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 36/125 (28%), Positives = 57/125 (45%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           K+   +T + +   G VD GKST  G L++    +    +   E+ + +   +  ++   
Sbjct: 12  KIASRET-LRLCTAGSVDDGKSTFVGRLLHDTKSVLADQLASVERTSADRGFEGLDLSLL 70

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
               R     GITID+A   F T K    + D PGH  + +N +TG S +   VL+V A 
Sbjct: 71  VDGLRAEREQGITIDVAYRYFATDKRTFILADTPGHVQYTRNTVTGVSTSQVVVLLVDAR 130

Query: 469 TGEFE 483
            G  E
Sbjct: 131 HGVVE 135



 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 30/75 (40%), Positives = 40/75 (53%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R H  ++  LGV+ +I+ VNK+D  +  YSE  F  I+KE       +      V  VPI
Sbjct: 138 RRHLSVSALLGVRTVILAVNKIDLVD--YSEEVFRNIEKEFVGLASALDVTDTHV--VPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           S   GDN+ EPST M
Sbjct: 194 SALKGDNVAEPSTHM 208


>UniRef50_Q7K3V6 Cluster: Elongation factor Tu; n=7; Coelomata|Rep:
           Elongation factor Tu - Drosophila melanogaster (Fruit
           fly)
          Length = 456

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 40/123 (32%), Positives = 62/123 (50%), Gaps = 3/123 (2%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHL--IYKCGGI-DKRTIEKFEKEAQEWVKDPSNMLGY 288
           +E  H N+  IGHVD GK+T T  +  I    G+ +  + ++ ++  +E  +        
Sbjct: 53  RELPHCNVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQIDRAPEEKAR-------- 104

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                     GITI+     + T++      D PGH D+IKNMI+G SQ D A+L+VAA 
Sbjct: 105 ----------GITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAAT 154

Query: 469 TGE 477
            G+
Sbjct: 155 DGQ 157


>UniRef50_UPI00006A2885 Cluster: UPI00006A2885 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2885 UniRef100 entry -
           Xenopus tropicalis
          Length = 315

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 25/53 (47%), Positives = 36/53 (67%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGE 477
           GITI+ +  ++ T+  +    D PGH D++KNMITGTSQ D  +L+VAA  G+
Sbjct: 29  GITINASHVEYATANRHYAHTDCPGHADYVKNMITGTSQMDGCILVVAATDGQ 81


>UniRef50_Q4QDW8 Cluster: Elongation factor TU, putative; n=5;
           Trypanosomatidae|Rep: Elongation factor TU, putative -
           Leishmania major
          Length = 466

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 41/120 (34%), Positives = 57/120 (47%), Gaps = 3/120 (2%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHL---IYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWT 294
           K H+ I  IGHVD GK+T T  +   + K G          +K  +E             
Sbjct: 21  KPHLIIGTIGHVDHGKTTLTSAITTVLAKRGQAQALDYFAIDKSPEE------------- 67

Query: 295 N*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                 S  ITI+    ++E+ K +   ID PGH DF+KNMITG +Q D  +++VAA  G
Sbjct: 68  -----KSRKITINATHVEYESEKRHYGHIDCPGHMDFVKNMITGAAQMDGGIIVVAATDG 122


>UniRef50_Q48791 Cluster: Tetracycline resistance protein tetS
           (Tet(S)); n=345; root|Rep: Tetracycline resistance
           protein tetS (Tet(S)) - Listeria monocytogenes
          Length = 641

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 37/114 (32%), Positives = 52/114 (45%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           INI ++ HVD+GK+T T  L+Y  G I      K              M        L  
Sbjct: 4   INIGILAHVDAGKTTLTESLLYSSGAI------KELGSVDSGTTKTDTMF-------LER 50

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             GITI  A+  F+     V I+D PGH DF+ ++    S  D A+L+++A  G
Sbjct: 51  QRGITIQTAITSFQRENVKVNIVDTPGHMDFLADVYRSLSVLDGAILLISAKDG 104


>UniRef50_A1W6V4 Cluster: Sulfate adenylyltransferase, large
           subunit; n=9; Burkholderiales|Rep: Sulfate
           adenylyltransferase, large subunit - Acidovorax sp.
           (strain JS42)
          Length = 462

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 40/113 (35%), Positives = 55/113 (48%), Gaps = 2/113 (1%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +  +  G VD GKST  G L+     +D R + +      +  +     L   T+  LS 
Sbjct: 28  LRFITCGSVDDGKSTLIGRLL-----VDSRAVLQDHLAGVQ--RGGETDLALLTD-GLSA 79

Query: 313 S--VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
               GITID+A   F T      I DAPGH  + +NM+T  SQAD AV++V A
Sbjct: 80  EREQGITIDVAYRYFATEARKFIIGDAPGHEQYTRNMVTAASQADAAVVLVDA 132



 Score = 37.9 bits (84), Expect = 0.26
 Identities = 22/70 (31%), Positives = 36/70 (51%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R H+LL   L V  L+  VNK+D+   P  +  +  I+  +  + +  G + A V  VP+
Sbjct: 149 RRHSLLVHLLRVHSLVFAVNKLDAVADP--QLAYRHIRAALEQFARHAGIDVAGV--VPV 204

Query: 690 SGWHGDNMLE 719
           S   G N++E
Sbjct: 205 SALKGWNVVE 214


>UniRef50_Q45W23 Cluster: Tuf1; n=1; uncultured Pseudonocardia
           sp.|Rep: Tuf1 - uncultured Pseudonocardia sp
          Length = 230

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 24/49 (48%), Positives = 34/49 (69%)
 Frame = +1

Query: 328 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           I IA  +++T K +   +D PGH D++KNMITG +Q D A+L+VAA  G
Sbjct: 1   ISIAHVEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDG 49


>UniRef50_A7QN79 Cluster: Chromosome undetermined scaffold_131,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_131, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 355

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 35/102 (34%), Positives = 53/102 (51%), Gaps = 4/102 (3%)
 Frame = +1

Query: 211 IDKRTIEKF----EKEAQEWVKDPSNMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTI 378
           I K+   KF    EK ++    D S  LG  TN       G T+++    FE      TI
Sbjct: 25  ISKKIFSKFWSSKEKLSENSSSDTSESLGS-TN-EEEKGKGKTVEVGRAHFEPETTRFTI 82

Query: 379 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNG 504
           +DA GH++++ NMI+G SQ D  +L++ A   +FE G  ++G
Sbjct: 83  LDAWGHKNYVPNMISGASQVDIGMLVIYAQKVKFETGGERSG 124


>UniRef50_Q5GBH8 Cluster: TetT; n=2; Lactobacillales|Rep: TetT -
           Enterococcus faecalis (Streptococcus faecalis)
          Length = 651

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 38/114 (33%), Positives = 53/114 (46%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           INI ++ HVD+GK+T T  L+YK G I+K             +    N      +  L  
Sbjct: 4   INIGILAHVDAGKTTVTEGLLYKSGAINK-------------IGRVDNATTTTDSMELER 50

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             GITI  +   F  +   V IID PGH DFI  +       D A+L+++A  G
Sbjct: 51  DRGITIRASTVSFNYNDTKVNIIDTPGHMDFIAEVERTLKVLDGAILVISAKEG 104


>UniRef50_A7PCT1 Cluster: Chromosome chr17 scaffold_12, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr17 scaffold_12, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 304

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 24/52 (46%), Positives = 35/52 (67%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GITI +A  ++ET+K +   +D PGH D+ KNMITG +Q D ++ +V A  G
Sbjct: 206 GITIAMAHVEYETAKRHYAHVDCPGHADYEKNMITGAAQMDVSIQVVFAPNG 257


>UniRef50_Q5WBK2 Cluster: Translation elongation factor G; n=1;
           Bacillus clausii KSM-K16|Rep: Translation elongation
           factor G - Bacillus clausii (strain KSM-K16)
          Length = 647

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 43/116 (37%), Positives = 57/116 (49%), Gaps = 2/116 (1%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           INI V+ HVD+GK+T T  ++Y+ G I         KEA    K      G  T   L++
Sbjct: 4   INIGVLAHVDAGKTTLTEQMLYQAGVI---------KEAGSVDK------GNTTTDTLAI 48

Query: 313 SV--GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
               GIT+  A   F  +   V IID PGH DFI  +    +  D A+LIV+A  G
Sbjct: 49  ERERGITVKAAAVSFFWNDVKVNIIDTPGHADFISEVEHALTILDGAILIVSAVEG 104


>UniRef50_Q8F2N6 Cluster: Peptide chain release factor 3; n=8;
           Bacteria|Rep: Peptide chain release factor 3 -
           Leptospira interrogans
          Length = 590

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 34/110 (30%), Positives = 51/110 (46%)
 Frame = +1

Query: 145 VIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGI 324
           +I H D+GK+T T  L+   G I      K  K  +    D       W    +    GI
Sbjct: 80  IIAHPDAGKTTLTEKLLLYGGAIQLAGAVKARKNRKAATSD-------WME--MEKEKGI 130

Query: 325 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +I  A  +FE S + + ++D PGH DF ++       AD AV+++ AG G
Sbjct: 131 SITSAALQFEYSGHVLNLLDTPGHEDFSEDTYRTLIAADTAVMVLDAGKG 180


>UniRef50_Q08RF5 Cluster: CysN/CysC bifunctional enzyme; n=2;
           Cystobacterineae|Rep: CysN/CysC bifunctional enzyme -
           Stigmatella aurantiaca DW4/3-1
          Length = 574

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 24/52 (46%), Positives = 31/52 (59%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GITID+A   F T +  V + D PGH  + +NM TG S AD AV++  A  G
Sbjct: 112 GITIDVAYRYFSTPRRKVIVADTPGHIQYTRNMATGASTADAAVILADARLG 163



 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 25/74 (33%), Positives = 41/74 (55%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           R HA +A  LG+  L V VNKMD  +  +    FE I +E++ + + +G+    +   P+
Sbjct: 169 RRHAYIASLLGIPYLAVAVNKMDMVD--FDRAVFERIGRELADFARPLGF--TQIRLFPV 224

Query: 690 SGWHGDNMLEPSTK 731
           S   GDN+ + ST+
Sbjct: 225 SARQGDNITQASTR 238



 Score = 39.1 bits (87), Expect = 0.11
 Identities = 15/31 (48%), Positives = 22/31 (70%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGI 213
           +K  + +VV+G VD GKST  G L+Y+C G+
Sbjct: 20  DKELLRLVVVGSVDDGKSTLIGRLLYECDGL 50


>UniRef50_P18905 Cluster: Elongation factor Tu; n=2;
           Coleochaetales|Rep: Elongation factor Tu - Coleochaete
           orbicularis
          Length = 415

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 35/118 (29%), Positives = 59/118 (50%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K H+N+  IGH   GK+T T  +     GI       + +  Q    D ++        
Sbjct: 12  KKIHLNVGTIGHFSHGKTTLTAAITAVLAGIG------YTQPKQNDAIDSTSE------- 58

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
               +  ++I +   ++ET+  + + +D PGH ++I NMITG SQ D A+L+V+A  G
Sbjct: 59  --EKARNMSIYVHHVEYETAARHYSHLDCPGHVNYINNMITGVSQMDGAILVVSAVDG 114


>UniRef50_Q4JIN1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; uncultured bacterium
           BAC10-10|Rep: Selenocysteine-specific translation
           elongation factor - uncultured bacterium BAC10-10
          Length = 634

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 6/58 (10%)
 Frame = +1

Query: 319 GITIDIALWKFE------TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GITID+     E      ++ + + I+D PGH DF+KNM+ G    D A+LIVAA  G
Sbjct: 41  GITIDLGFAHLEIPSPDPSASFLLGIVDVPGHEDFVKNMVAGVGSIDLALLIVAADDG 98


>UniRef50_A0JZN0 Cluster: Sulfate adenylyltransferase, large
           subunit; n=2; Arthrobacter|Rep: Sulfate
           adenylyltransferase, large subunit - Arthrobacter sp.
           (strain FB24)
          Length = 477

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 35/119 (29%), Positives = 51/119 (42%), Gaps = 8/119 (6%)
 Frame = +1

Query: 151 GHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG--------YWTN*RL 306
           G VD GKST  G L++    I    ++   + + +     +   G             R 
Sbjct: 31  GSVDDGKSTLVGRLLHDSKAILADQLDAVARTSADRGFGGAGATGTKAIDLALLTDGLRA 90

Query: 307 SVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
               GITID+A   F T +    + D PGH  + KN +TG S AD  V+++ A  G  E
Sbjct: 91  EREQGITIDVAYRYFATDRRSFILADCPGHVQYTKNTVTGASTADAVVVLIDARKGVLE 149



 Score = 37.5 bits (83), Expect = 0.34
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 3/77 (3%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVA---F 680
           R H  +   L V  +IV VNK+D  +  +SE  F  I+ +V    +++G     +     
Sbjct: 152 RRHLSVLQLLRVAHVIVAVNKIDLVD--FSEDVFRGIEADVQKVGRELGLGADGITDLLV 209

Query: 681 VPISGWHGDNMLEPSTK 731
           VP+S   GDN++E S +
Sbjct: 210 VPVSALDGDNVVERSER 226


>UniRef50_Q8TVI5 Cluster: Translation elongation factor, GTPase;
           n=1; Methanopyrus kandleri|Rep: Translation elongation
           factor, GTPase - Methanopyrus kandleri
          Length = 358

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +1

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +G+TI+ A    E     V+ +D PGHRD+I+NM+     AD A+L+VAA  G
Sbjct: 45  MGVTIEPARAFLELGDTTVSFVDVPGHRDYIRNMLASAWSADYAILVVAADEG 97


>UniRef50_Q1FK57 Cluster: Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit; n=3;
           Clostridiales|Rep: Small GTP-binding protein
           domain:Sulfate adenylyltransferase, large subunit -
           Clostridium phytofermentans ISDg
          Length = 563

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 32/116 (27%), Positives = 49/116 (42%), Gaps = 2/116 (1%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIY--KCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RL 306
           +  +  G VD GKST  GH++Y  K    D+      + +      +    L        
Sbjct: 5   LKFITCGSVDDGKSTLIGHILYDSKLLYTDQENALMLDSKVGSRGGEIDYSL-LLDGLEA 63

Query: 307 SVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
               GITID+A   F T      + D PGH ++ +NM  G S A   ++++ A  G
Sbjct: 64  EREQGITIDVAYRYFTTKNRSFIVADTPGHEEYTRNMAVGASFAQLTIILIDAKQG 119



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/75 (32%), Positives = 39/75 (52%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           + H+ +   +G+   +  VNKMD  +  YSE RF EIK+ +    K +  +   V  +P+
Sbjct: 125 KRHSRICSFMGIHHFVFAVNKMDLVD--YSEERFLEIKRNILELAKDLSLH--NVKIIPV 180

Query: 690 SGWHGDNMLEPSTKM 734
           S   GDN+ + S  M
Sbjct: 181 SATLGDNVTKKSDHM 195


>UniRef50_Q46306 Cluster: Tetracycline resistance protein tetP
           (TetB(P)); n=4; Clostridium|Rep: Tetracycline resistance
           protein tetP (TetB(P)) - Clostridium perfringens
          Length = 652

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 36/117 (30%), Positives = 57/117 (48%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  INI ++ HVD+GK+T T +L+Y  G I  +++ + +    +      +M        
Sbjct: 2   KKIINIGIVAHVDAGKTTITENLLYYSGAI--KSVGRVDLGNTQ----TDSM-------E 48

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           L    GITI  +   F  +   V IID PGH DFI  +    +  D A+L+++   G
Sbjct: 49  LERKRGITIKSSTISFNWNNVKVNIIDTPGHVDFISEVERSLNSLDGAILVISGVEG 105


>UniRef50_Q7UN30 Cluster: Elongation factor G; n=2;
           Planctomycetaceae|Rep: Elongation factor G -
           Rhodopirellula baltica
          Length = 724

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 37/126 (29%), Positives = 56/126 (44%), Gaps = 1/126 (0%)
 Frame = +1

Query: 100 H*PKMGKEKTHI-NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSN 276
           H P M  + + I NI +I H+D+GK+T T  ++Y  G   K  + + +    +   DP  
Sbjct: 24  HRPAMAADISKIRNIGIIAHIDAGKTTVTERMLYLSGA--KHRVGRVDHGTTDTDDDPEE 81

Query: 277 MLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI 456
                         GITI  A  K+    Y V ++D PGH DF   +       D AV++
Sbjct: 82  Q-----------ERGITIFSACVKYAWGDYNVNLLDTPGHVDFTAEVERCLRVLDGAVVV 130

Query: 457 VAAGTG 474
            +A  G
Sbjct: 131 FSAREG 136


>UniRef50_A7Q762 Cluster: Chromosome chr5 scaffold_58, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_58, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 177

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 21/47 (44%), Positives = 32/47 (68%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 459
           GITI     ++ET+K +   +D PGH D++KNMITG +Q D ++ +V
Sbjct: 102 GITIATTHVEYETAKRHCDHVDCPGHADYVKNMITGAAQMDGSIQVV 148


>UniRef50_Q8I592 Cluster: Elongation factor g, putative; n=1;
           Plasmodium falciparum 3D7|Rep: Elongation factor g,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 803

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 37/128 (28%), Positives = 56/128 (43%), Gaps = 4/128 (3%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+D+GK+T T  ++Y  G I         K   E V+    +     +  L   
Sbjct: 46  NIGISAHIDAGKTTLTERILYYTGKI---------KSIHE-VRGNDGVGATMDSMELERE 95

Query: 316 VGITIDIA----LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
            GITI  A    +W+    KY + IID PGH DF   +       D A+L++   +G   
Sbjct: 96  KGITIQSATTNCVWEINNKKYNINIIDTPGHVDFTIEVERSLRVLDSAILVICGVSGVQS 155

Query: 484 AGISKNGQ 507
             ++ N Q
Sbjct: 156 QTLTVNRQ 163


>UniRef50_Q24BY4 Cluster: Elongation factor Tu GTP binding domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu GTP binding domain
           containing protein - Tetrahymena thermophila SB210
          Length = 874

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 37/113 (32%), Positives = 52/113 (46%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +I H+D+GK+TTT  ++Y  G +    +E  E      V D + ++ Y    R    
Sbjct: 67  NIGIIAHIDAGKTTTTERMLYYAGAL----VEPGE------VHDGNTVMDYLQQER---D 113

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F  + Y   +ID PGH DF   +       D AV I    +G
Sbjct: 114 RGITIRAAAISFNWNNYQFNLIDTPGHIDFTGEVERSLRVLDGAVAIFDGVSG 166


>UniRef50_Q67MT5 Cluster: Peptide chain release factor 3; n=13;
           Bacteria|Rep: Peptide chain release factor 3 -
           Symbiobacterium thermophilum
          Length = 528

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 33/110 (30%), Positives = 51/110 (46%)
 Frame = +1

Query: 145 VIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGI 324
           +I H D+GK+T T  L+   G I      K  K A+    D       W    +    GI
Sbjct: 16  IISHPDAGKTTLTEKLLLYGGAIRLAGAVKGRKAARAATSD-------WME--IEKQRGI 66

Query: 325 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           ++  ++ +FE     V I+D PGH+DF ++       AD AV+++ A  G
Sbjct: 67  SVTTSVMQFEYGGCMVNILDTPGHQDFSEDTYRTLEAADSAVMLIDAAKG 116


>UniRef50_A1ZR77 Cluster: Translation elongation factor G; n=2;
           Bacteroidetes/Chlorobi group|Rep: Translation elongation
           factor G - Microscilla marina ATCC 23134
          Length = 697

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 30/113 (26%), Positives = 49/113 (43%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N+ ++ HVD+GK+TTT  ++Y  G I K           +   DP          +  ++
Sbjct: 9   NLGIMAHVDAGKTTTTERILYYTGMIHKMGEVHHGNTTMD--SDPQEE-------KRGIT 59

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +        W+ +  KY   +ID PGH DF   +       D AV++  A +G
Sbjct: 60  ISSAAITTFWQHQGQKYQFNLIDTPGHVDFTVEVERSLRVLDGAVMLFCAASG 112


>UniRef50_Q4Y6S3 Cluster: Elongation factor g, putative; n=4;
           Plasmodium|Rep: Elongation factor g, putative -
           Plasmodium chabaudi
          Length = 776

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 38/128 (29%), Positives = 56/128 (43%), Gaps = 4/128 (3%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+D+GK+T T  ++Y  G I         K   E V+    +     +  L   
Sbjct: 44  NIGISAHIDAGKTTLTERILYYTGKI---------KSIHE-VRGTDGVGATMDSMDLERE 93

Query: 316 VGITIDIA----LWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 483
            GITI  A    +W    +KY + IID PGH DF   +       D AVL++   +G   
Sbjct: 94  KGITIQSAATHCVWNVNNNKYDINIIDTPGHVDFTIEVERSLRVLDAAVLVICGVSGVQS 153

Query: 484 AGISKNGQ 507
             ++ N Q
Sbjct: 154 QTLTVNRQ 161


>UniRef50_Q55002 Cluster: Oxytetracycline resistance protein; n=2;
           Streptomyces|Rep: Oxytetracycline resistance protein -
           Streptomyces rimosus
          Length = 663

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 37/114 (32%), Positives = 53/114 (46%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +N+ ++ HVD+GK++ T  L+++ G ID    E    +A     D            L  
Sbjct: 4   LNLGILAHVDAGKTSLTERLLHRTGVID----EVGSVDAGTTTTDSME---------LER 50

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             GITI  A+  F      V +ID PGH DFI  +       D AVL+V+A  G
Sbjct: 51  QRGITIRSAVATFVLDDLKVNLIDTPGHSDFISEVERALGVLDGAVLVVSAVEG 104


>UniRef50_A7ANX2 Cluster: Elongation factor Tu GTP binding domain
           containing protein; n=1; Babesia bovis|Rep: Elongation
           factor Tu GTP binding domain containing protein -
           Babesia bovis
          Length = 601

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 35/121 (28%), Positives = 53/121 (43%), Gaps = 10/121 (8%)
 Frame = +1

Query: 127 THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKF----------EKEAQEWVKDPSN 276
           T +N+VV G VD GKST  GHL+   G +D R + +           ++ A+    DP+ 
Sbjct: 113 TSLNVVVCGRVDVGKSTLLGHLLTLLGAVDSRLLRESDMAWILDQGEDERARGITIDPTK 172

Query: 277 MLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI 456
                     S S   +    +         +  ID PGH D I N++ G S A  A+++
Sbjct: 173 ASAIINLREPSESNAGSPTEEMAVTYPVNVKIDFIDTPGHHDLIANLVKGASFARAAIVV 232

Query: 457 V 459
           V
Sbjct: 233 V 233



 Score = 34.3 bits (75), Expect = 3.1
 Identities = 18/69 (26%), Positives = 35/69 (50%)
 Frame = +3

Query: 513 EHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPIS 692
           +H  + + LGV++ I+ VNK+D  E       ++E +  V    K       ++  +P S
Sbjct: 249 QHLFILWALGVREFIICVNKVDRLE---DVQMYKEAESRVKELTKPF-TGSTSITIIPTS 304

Query: 693 GWHGDNMLE 719
           G +G N+++
Sbjct: 305 GLNGINLVK 313


>UniRef50_P0A3B4 Cluster: GTP-binding protein typA/bipA; n=97;
           Bacteria|Rep: GTP-binding protein typA/bipA - Shigella
           flexneri
          Length = 607

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 37/113 (32%), Positives = 50/113 (44%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +I HVD GK+T    L+ + G  D R       E QE V D ++         L   
Sbjct: 7   NIAIIAHVDHGKTTLVDKLLQQSGTFDSRA------ETQERVMDSND---------LEKE 51

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI       + + Y + I+D PGH DF   +    S  D  +L+V A  G
Sbjct: 52  RGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDG 104


>UniRef50_Q6MAV2 Cluster: Probable peptide chain release factor 3;
           n=2; Chlamydiae/Verrucomicrobia group|Rep: Probable
           peptide chain release factor 3 - Protochlamydia
           amoebophila (strain UWE25)
          Length = 533

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 29/110 (26%), Positives = 51/110 (46%)
 Frame = +1

Query: 145 VIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGI 324
           +I H D+GK+T T  L+   G I    + +  K  +    D       W    +    GI
Sbjct: 20  IISHPDAGKTTLTEKLLLYSGMIHTAGMVRGRKGRKAAASD-------WM--AMEQERGI 70

Query: 325 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +I  +  +F  +   + ++D PGH DF ++     + ADCA++++ A  G
Sbjct: 71  SITASAMQFTYNNTIINVLDTPGHEDFSEDTYRTLTAADCAIMVIDAAKG 120


>UniRef50_Q4U972 Cluster: Translation elongation factor 1-alpha,
           putative; n=3; Theileria|Rep: Translation elongation
           factor 1-alpha, putative - Theileria annulata
          Length = 577

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/74 (32%), Positives = 43/74 (58%)
 Frame = +3

Query: 513 EHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPIS 692
           EH LL + LG++ +I+ VNK+D  E  YSE  + ++  E+   +  +      + F+P+S
Sbjct: 234 EHMLLLYLLGIRYIIICVNKIDRFE--YSETMYNKV-VEIIRKLVVVYEKSVKLIFLPVS 290

Query: 693 GWHGDNMLEPSTKM 734
           G  GDN+++ S  +
Sbjct: 291 GLRGDNLIDKSNNL 304



 Score = 36.7 bits (81), Expect = 0.59
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIV 459
           V +ID PGH D I+N++ G   A+ A++IV
Sbjct: 188 VNVIDTPGHHDLIQNLVMGAVFANSAIIIV 217



 Score = 35.5 bits (78), Expect = 1.4
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKR 222
           +N+VV+G VD+GKST  GH +     +DK+
Sbjct: 98  LNVVVLGAVDAGKSTLLGHFLTLTNCVDKK 127


>UniRef50_Q1VQ31 Cluster: Tetracycline resistance protein; n=1;
           Psychroflexus torquis ATCC 700755|Rep: Tetracycline
           resistance protein - Psychroflexus torquis ATCC 700755
          Length = 660

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 36/118 (30%), Positives = 55/118 (46%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K  INI ++ HVD+GK+T T   +Y  G I  + +   +K +       ++ L      
Sbjct: 2   KKPTINIGILAHVDAGKTTLTEQFLYNSGAI--KILGSVDKGSTR-----TDSLD----- 49

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            +    GI+I  A   FE     + +ID PGH DF   +       D AVL+V+A  G
Sbjct: 50  -IEKERGISIKAATTSFEWKGVKINLIDTPGHVDFSSEVERVLCIVDTAVLVVSAVEG 106


>UniRef50_Q1MPY9 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Lawsonia intracellularis
           PHE/MN1-00|Rep: Selenocysteine-specific translation
           elongation factor - Lawsonia intracellularis (strain
           PHE/MN1-00)
          Length = 641

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIAL-WKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GITID+   +    +   ++IID PGH  FIKNM+ G S  D  +L++AA  G
Sbjct: 37  GITIDLGFAYYVSPTGEKLSIIDVPGHEKFIKNMVAGASGIDVVMLVIAADEG 89


>UniRef50_A3LLY2 Cluster: GTP-binding protein LepA; n=4;
           Bacteria|Rep: GTP-binding protein LepA - Pseudomonas
           aeruginosa 2192
          Length = 617

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 43/122 (35%), Positives = 57/122 (46%), Gaps = 6/122 (4%)
 Frame = +1

Query: 127 THI-NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           +HI N  +I H+D GKST     I  CGG+  R     E EAQ  V D  +         
Sbjct: 5   SHIRNFSIIAHIDHGKSTLADRFIQMCGGLSDR-----EMEAQ--VLDSMD--------- 48

Query: 304 LSVSVGITI---DIAL-WKFETSK-YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
           L    GITI    + L +K +  K Y +  ID PGH DF   +    +  + A+L+V AG
Sbjct: 49  LERERGITIKAHSVTLHYKAQDGKTYQLNFIDTPGHVDFTYEVSRSLAACEGALLVVDAG 108

Query: 469 TG 474
            G
Sbjct: 109 QG 110


>UniRef50_Q57918 Cluster: Selenocysteine-specific elongation factor;
           n=7; Methanococcales|Rep: Selenocysteine-specific
           elongation factor - Methanococcus jannaschii
          Length = 469

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/52 (40%), Positives = 31/52 (59%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GITID+    F   +Y +T++DAPGH + I+  I   +  D A+L+V A  G
Sbjct: 48  GITIDLGFSSFTLDRYRITLVDAPGHSELIRTAIGAGNIIDAALLVVDAKEG 99


>UniRef50_A7PSI5 Cluster: Chromosome chr6 scaffold_28, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr6 scaffold_28, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 154

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 20/35 (57%), Positives = 27/35 (77%)
 Frame = -1

Query: 441 ISLRGSCDHVLDEISVSRSINDGNIVLASFELPES 337
           ISLRG+ DHVLDE+++SRSIND  +  +  +LP S
Sbjct: 92  ISLRGTSDHVLDEVTMSRSINDSAVTFSGLKLPRS 126


>UniRef50_Q7Q3I6 Cluster: ENSANGP00000010178; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000010178 - Anopheles gambiae
           str. PEST
          Length = 682

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 30/113 (26%), Positives = 48/113 (42%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  ++Y  G  D     K      ++++                 
Sbjct: 5   NIGILAHIDAGKTTTTERMLYYSGRTDMLGEVKLGNTVTDFLQQERER------------ 52

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F   +Y + ++D PGH DF   +       D  V+I+    G
Sbjct: 53  -GITICSAAVSFNWKEYRINLLDTPGHIDFTMEVEQSLGAVDGTVIILDGSAG 104


>UniRef50_UPI0000519D80 Cluster: PREDICTED: similar to mitochondrial
           elongation factor G2 isoform 1; n=1; Apis mellifera|Rep:
           PREDICTED: similar to mitochondrial elongation factor G2
           isoform 1 - Apis mellifera
          Length = 740

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 37/113 (32%), Positives = 51/113 (45%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  ++Y  G I         K   E V   + +  Y    R    
Sbjct: 40  NIGILAHIDAGKTTTTERMLYYSGLI---------KHMGE-VHYGNTVTDYMDQER---Q 86

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   FE   Y + +ID PGH DF   +       D AV+I+    G
Sbjct: 87  RGITITSAAVTFEWKNYCINLIDTPGHIDFTMEVEQTLRVLDGAVVILDGSAG 139


>UniRef50_Q6WZ47 Cluster: Elongation factor-1 alpha; n=3;
           Coelomata|Rep: Elongation factor-1 alpha - Anduzedoras
           oxyrhynchus
          Length = 257

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 19/21 (90%), Positives = 20/21 (95%)
 Frame = +3

Query: 672 VAFVPISGWHGDNMLEPSTKM 734
           VAFVPISGWHGDNMLEPS+ M
Sbjct: 1   VAFVPISGWHGDNMLEPSSNM 21


>UniRef50_Q8UFQ0 Cluster: Tetracycline resistance protein, tetM/tetO
           subfamily; n=2; Rhizobium/Agrobacterium group|Rep:
           Tetracycline resistance protein, tetM/tetO subfamily -
           Agrobacterium tumefaciens (strain C58 / ATCC 33970)
          Length = 649

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 36/114 (31%), Positives = 52/114 (45%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +N+ ++ HVD+GK++ T  L++  G IDK               D  N      +  L  
Sbjct: 4   LNLGILAHVDAGKTSLTERLLFDVGVIDKLGSV-----------DTGNT--QTDSLELER 50

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             GITI  A+  F      V +ID PGH DFI  +       D AV++V+A  G
Sbjct: 51  QRGITIRAAVVSFTIGDTVVNLIDTPGHPDFIAEVERVLGLLDAAVVVVSAVEG 104


>UniRef50_Q73LA2 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Treponema denticola|Rep:
           Selenocysteine-specific translation elongation factor -
           Treponema denticola
          Length = 590

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIALWKFETSKY-YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           G+TI++     E   +  V I+D PGH  FI+NM+ GT   D A+LIVAA  G
Sbjct: 37  GMTIELGFASLEDPVHGTVGIVDVPGHERFIRNMVAGTWGLDAALLIVAADDG 89


>UniRef50_A5Z9F8 Cluster: Putative uncharacterized protein; n=1;
           Eubacterium ventriosum ATCC 27560|Rep: Putative
           uncharacterized protein - Eubacterium ventriosum ATCC
           27560
          Length = 535

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 30/110 (27%), Positives = 51/110 (46%)
 Frame = +1

Query: 145 VIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGI 324
           +I H D+GK+T T   +   G I+     K +  ++  V D       W    +    GI
Sbjct: 21  IISHPDAGKTTLTEKFLLYGGAINTAGSVKGKANSKYAVSD-------WMG--IEKERGI 71

Query: 325 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           ++  +  +F    Y + I+D PGH+DF ++       AD AV+++ A  G
Sbjct: 72  SVTSSALQFNYEGYCINILDTPGHQDFSEDTYRTLMAADSAVMVIDASKG 121


>UniRef50_A0YH51 Cluster: Selenocysteine-specific elongation factor;
           n=1; marine gamma proteobacterium HTCC2143|Rep:
           Selenocysteine-specific elongation factor - marine gamma
           proteobacterium HTCC2143
          Length = 642

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/52 (40%), Positives = 30/52 (57%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           G+TI++           V  ID PGH+ FI NM+TG +  D A+L++AA  G
Sbjct: 35  GLTIELGFAYHHNEDIAVGFIDVPGHQKFIANMLTGIAALDLALLVIAADDG 86


>UniRef50_A5DTX8 Cluster: Putative uncharacterized protein; n=3;
           Saccharomycetales|Rep: Putative uncharacterized protein
           - Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 826

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 38/113 (33%), Positives = 51/113 (45%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +I H+D+GK+TTT  +IY  G   KR            V +   +  Y    R    
Sbjct: 57  NIGIIAHIDAGKTTTTERMIYYSGK-SKRIGN---------VDEGDTVTDYLQAER---E 103

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI +A      + + + IID PGH DF   +I      D AV I+ A  G
Sbjct: 104 RGITIQLAAITIPWNNHKINIIDTPGHADFTFEVIRSLRVLDGAVTILDAVAG 156


>UniRef50_P73473 Cluster: Peptide chain release factor 3; n=49;
           Bacteria|Rep: Peptide chain release factor 3 -
           Synechocystis sp. (strain PCC 6803)
          Length = 547

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 30/113 (26%), Positives = 52/113 (46%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N  +I H D+GK+T T  L+   G I +    K  +  +    D       W    +   
Sbjct: 28  NFAIISHPDAGKTTLTEKLLLYGGAIQEAGAVKARRSQRSATSD-------WM--AMEQQ 78

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GI+I   + +F+     + ++D PGH+DF ++     + AD AV+++ A  G
Sbjct: 79  RGISITSTVLQFDYRGKILNLLDTPGHQDFSEDTYRTLAAADNAVMLIDAAKG 131


>UniRef50_Q81NX9 Cluster: GTP-binding elongation factor protein,
           TetM/TetO family; n=9; Bacillus cereus group|Rep:
           GTP-binding elongation factor protein, TetM/TetO family
           - Bacillus anthracis
          Length = 647

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 33/116 (28%), Positives = 56/116 (48%)
 Frame = +1

Query: 127 THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RL 306
           T INI ++ HVD+GK++ T  ++Y+   I  + + + +  + +      +M        L
Sbjct: 2   TTINIEIVAHVDAGKTSLTERILYETNVI--KEVGRVDSGSTQ----TDSM-------EL 48

Query: 307 SVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
               GITI  ++  F      V +ID PGH DFI  +       D A+L+++A  G
Sbjct: 49  ERQRGITIKASVVSFFIDDIKVNVIDTPGHADFIAEVERSFRVLDGAILVISAVEG 104


>UniRef50_Q67QI5 Cluster: Selenocysteine-specific elongation factor;
           n=1; Symbiobacterium thermophilum|Rep:
           Selenocysteine-specific elongation factor -
           Symbiobacterium thermophilum
          Length = 629

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GI+IDI   +F   S     +ID PGH  F++NM+ G +  D  +L+VAA  G
Sbjct: 38  GISIDIGFARFPLPSGRRAAVIDVPGHEKFVRNMLAGITGIDLVILVVAADEG 90


>UniRef50_A4FHF5 Cluster: Tetracycline resistance protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: Tetracycline
           resistance protein - Saccharopolyspora erythraea (strain
           NRRL 23338)
          Length = 594

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 36/114 (31%), Positives = 52/114 (45%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +N+ ++ HVD+GK++ T  L++  G +D         E    V D S          L  
Sbjct: 4   LNLGILAHVDAGKTSLTERLLHSAGVVD---------EVGN-VDDGSTRTDSTA---LER 50

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             GITI  A+  F      V +ID PGH DFI  +       D AVL+++A  G
Sbjct: 51  QRGITIRSAVVSFVVGDVAVNLIDTPGHPDFIAEVERALGVLDGAVLVISAVEG 104


>UniRef50_Q89AC9 Cluster: GTP-binding protein TypA/BipA homolog;
           n=93; Bacteria|Rep: GTP-binding protein TypA/BipA
           homolog - Buchnera aphidicola subsp. Baizongia pistaciae
          Length = 611

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 38/113 (33%), Positives = 51/113 (45%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +I HVD GK+T    L+ + G     T +K E E  E + D ++         L   
Sbjct: 11  NIAIIAHVDHGKTTLVDKLLQQSG-----TFKKHE-EFSERIMDSND---------LEKE 55

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI       +  KY + IID PGH DF   +    S  D  +L+V A  G
Sbjct: 56  RGITILAKNTAIQWKKYRINIIDTPGHADFGGEVERILSMVDSVLLVVDALEG 108


>UniRef50_Q92IQ1 Cluster: GTP-binding protein lepA; n=187;
           Bacteria|Rep: GTP-binding protein lepA - Rickettsia
           conorii
          Length = 600

 Score = 46.8 bits (106), Expect = 6e-04
 Identities = 29/121 (23%), Positives = 56/121 (46%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           M  +K   N  +I H+D GKST    LI  CGG+  R + +   ++ +  K+        
Sbjct: 1   MNHQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERG------ 54

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
               +++    T+ +     + + YY+ ++D PGH DF   +    +  + ++L+V +  
Sbjct: 55  ----ITIKAQ-TVRLVYKAKDGNNYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQ 109

Query: 472 G 474
           G
Sbjct: 110 G 110


>UniRef50_UPI0000D62D3D Cluster: UPI0000D62D3D related cluster; n=1;
           Mus musculus|Rep: UPI0000D62D3D UniRef100 entry - Mus
           musculus
          Length = 787

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 40/123 (32%), Positives = 58/123 (47%), Gaps = 5/123 (4%)
 Frame = +1

Query: 121 EKTHI-NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFE---KEAQEW-VKDPSNMLG 285
           +K +I N+ VI HVD GKS  T  L+ K G ID+    +F    K+ QE  +   S  + 
Sbjct: 14  DKANIQNMSVIAHVDHGKSMLTDTLVCKVGIIDRIGETRFTDTCKDEQECCITIKSTAIF 73

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
           Y     L+ +    I       + S + +  ID+PGH DF   M T  S  D A+ +V  
Sbjct: 74  Y----ELAENDLYFIKFITTIKDGSGFLINFIDSPGHLDFFSEMRTALSVTDGALAVVDC 129

Query: 466 GTG 474
            +G
Sbjct: 130 VSG 132


>UniRef50_A1HSM1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Thermosinus carboxydivorans
           Nor1|Rep: Selenocysteine-specific translation elongation
           factor - Thermosinus carboxydivorans Nor1
          Length = 623

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVT-IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GI+ID+       +   V  ++D PGH  F+KNM+ GT   D A+L+VAA  G
Sbjct: 38  GISIDLGFASLPLADDIVAGVVDVPGHERFLKNMLAGTGGIDMAMLVVAADEG 90


>UniRef50_Q6AJD2 Cluster: Peptide chain release factor 3; n=41;
           Bacteria|Rep: Peptide chain release factor 3 -
           Desulfotalea psychrophila
          Length = 528

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 27/110 (24%), Positives = 53/110 (48%)
 Frame = +1

Query: 145 VIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGI 324
           +I H D+GK+T T  L+   G I+     K  K  ++   D       W    +    GI
Sbjct: 17  IISHPDAGKTTLTEKLLLFGGAINMAGAVKSRKIERKATSD-------WM--AIEQERGI 67

Query: 325 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           ++  ++ KF   ++ + ++D PGH+DF ++     +  D A++++ +  G
Sbjct: 68  SVTTSVMKFTYREHEINLLDTPGHQDFSEDTYRVLTAVDSAIMVIDSAKG 117


>UniRef50_A6CK31 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Bacillus sp. SG-1|Rep:
           Selenocysteine-specific translation elongation factor -
           Bacillus sp. SG-1
          Length = 630

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIALWKF-ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GI+I++      ET    ++++D PGH  FIK MI G +  D  +L+VAA  G
Sbjct: 40  GISIELGFAPLMETEDMDISVVDVPGHEKFIKQMIAGVAGIDLVILVVAADEG 92


>UniRef50_A0UWB2 Cluster: Small GTP-binding protein; n=14;
           Bacteria|Rep: Small GTP-binding protein - Clostridium
           cellulolyticum H10
          Length = 918

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 34/112 (30%), Positives = 49/112 (43%)
 Frame = +1

Query: 139 IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSV 318
           I ++ HVD+GK+T +  ++Y  G I K             +    N   Y     L  + 
Sbjct: 44  IGILAHVDAGKTTLSESILYLSGKIGK-------------LGRVDNKDAYLDTYELERAR 90

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GITI      FET    +T++D PGH DF   M       D AVL+++   G
Sbjct: 91  GITIFSKQAVFETGGINITLLDTPGHIDFSAEMERTLQVLDYAVLVISGADG 142


>UniRef50_Q7Q1K8 Cluster: ENSANGP00000010217; n=2; Coelomata|Rep:
           ENSANGP00000010217 - Anopheles gambiae str. PEST
          Length = 668

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 38/124 (30%), Positives = 54/124 (43%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+DSGK+T T  +++  G I         KE  E VK   N+     +  L   
Sbjct: 7   NIGISAHIDSGKTTLTERILFYTGRI---------KEMHE-VKGKDNVGATMDSMELERQ 56

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 495
            GITI  A        + + IID PGH DF   +       D AVL++ +  G     ++
Sbjct: 57  RGITIQSAATYTIWKDHNINIIDTPGHVDFTVEVERALRVLDGAVLVLCSVGGVQSQTLT 116

Query: 496 KNGQ 507
            N Q
Sbjct: 117 VNRQ 120


>UniRef50_Q6CBI0 Cluster: Yarrowia lipolytica chromosome C of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome C of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 802

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 36/113 (31%), Positives = 51/113 (45%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +I H+D+GK+TTT  ++Y  G     TI+         V +    + +    R    
Sbjct: 17  NIGIIAHIDAGKTTTTERILYLSG-----TIKHLGN-----VDEGDTTMDFLPAER---E 63

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F  + + V +ID PGH DF   +I      D AV I+    G
Sbjct: 64  RGITIASAATSFNWNNHTVNLIDTPGHADFTFEVIRSIRVLDGAVCILDGVAG 116


>UniRef50_A5HWL3 Cluster: Elongation factor 1-alpha; n=6; Gloeoporus
           taxicola|Rep: Elongation factor 1-alpha - Gloeoporus
           taxicola
          Length = 97

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/38 (57%), Positives = 24/38 (63%)
 Frame = +1

Query: 616 KSRRKYPHTSRRLATTQLLSLSCPFLDGTETTCWSLQP 729
           KS R+ P +SRRL TT   S SCP L GT TTCW   P
Sbjct: 27  KSSRRXPPSSRRLVTTPRPSPSCPSLAGTVTTCWRSLP 64


>UniRef50_A7H0F4 Cluster: Selenocysteine-specific translation
           elongation factor; n=13; Campylobacter|Rep:
           Selenocysteine-specific translation elongation factor -
           Campylobacter curvus 525.92
          Length = 605

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/52 (38%), Positives = 28/52 (53%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GITID++    +     +  ID PGH   +K MI+G    D  +L+VAA  G
Sbjct: 37  GITIDLSFSNLKRGDENIAFIDVPGHESLVKTMISGAFGFDACLLVVAANEG 88


>UniRef50_A0Q2C8 Cluster: Translation elongation factor G; n=1;
           Clostridium novyi NT|Rep: Translation elongation factor
           G - Clostridium novyi (strain NT)
          Length = 666

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 36/113 (31%), Positives = 52/113 (46%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ HVD GK+TTT  ++Y  G I  R +   +K + +        + Y +   +   
Sbjct: 6   NIGLVAHVDGGKTTTTEQMLYISGAI--RELGSVDKGSAK--------MDYNS---IEKK 52

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI      F      + +ID PGH DF   +       D AVLIV+A  G
Sbjct: 53  RGITIFSDQTSFTWKDACINLIDTPGHIDFSSELERSLKALDGAVLIVSAVEG 105


>UniRef50_Q46497 Cluster: Selenocysteine-specific elongation factor;
           n=4; Desulfovibrionales|Rep: Selenocysteine-specific
           elongation factor - Desulfovibrio baculatus
           (Desulfomicrobium baculatus)
          Length = 634

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIALWKFE-TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GITI++     + T +  + IID PGH  F+KNM++G +  D  +L++AA  G
Sbjct: 37  GITIELGFAYLDLTPEVRLGIIDVPGHERFVKNMVSGAAGIDFVLLVIAADEG 89


>UniRef50_Q7VI67 Cluster: Selenocysteine-specific elongation factor
           SelB; n=2; Helicobacteraceae|Rep:
           Selenocysteine-specific elongation factor SelB -
           Helicobacter hepaticus
          Length = 632

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/52 (38%), Positives = 27/52 (51%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GIT+D++          V  ID PGH   +KNMI G    D  +L++AA  G
Sbjct: 42  GITLDLSFSHLHLPSRNVAFIDVPGHNKLVKNMIAGAFGIDVLLLVIAANEG 93


>UniRef50_Q30SC0 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; Thiomicrospira
           denitrificans ATCC 33889|Rep: Translation elongation
           factor, selenocysteine-specific - Thiomicrospira
           denitrificans (strain ATCC 33889 / DSM 1351)
          Length = 611

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/52 (36%), Positives = 27/52 (51%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GITID++          +  ID PGH   +KNMI G    DC +++V+   G
Sbjct: 38  GITIDLSFSNITKDGKNIAFIDVPGHEKLVKNMIAGAFSFDCVLIVVSVIDG 89


>UniRef50_Q9AIG7 Cluster: Elongation factor G; n=2; Candidatus
           Carsonella ruddii|Rep: Elongation factor G - Carsonella
           ruddii
          Length = 681

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 32/113 (28%), Positives = 48/113 (42%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +I HVD+GK+TTT  +++  G   K           +W+K      G         S
Sbjct: 9   NIGIIAHVDAGKTTTTERILFFSGFSHKIGEVHTGNTITDWMKQEQER-GITIT-----S 62

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             +T     WK       + +ID PGH DF   +       D AV+++ A +G
Sbjct: 63  ASVTF---FWKTNFYNSSINLIDTPGHVDFTIEVERSLRVLDGAVILICASSG 112


>UniRef50_Q1IY97 Cluster: Peptide chain release factor 3; n=1;
           Deinococcus geothermalis DSM 11300|Rep: Peptide chain
           release factor 3 - Deinococcus geothermalis (strain DSM
           11300)
          Length = 567

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 30/110 (27%), Positives = 53/110 (48%)
 Frame = +1

Query: 145 VIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGI 324
           +I H D+GK+T T  L+   G I +       KE +   K        W +  +    GI
Sbjct: 58  IISHPDAGKTTITEKLLLYGGAIQEAG-SVTAKEGRAHTKSD------WMS--IEQQRGI 108

Query: 325 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +I  +   FE +  ++ ++D PGH+DF ++     + AD A++++ A  G
Sbjct: 109 SISSSALTFEYAGRHINLLDTPGHQDFSEDTYRTLTAADSALMVLDAARG 158


>UniRef50_Q1ETS8 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=6; Clostridiales|Rep: Translation elongation
           factor, selenocysteine-specific:Small GTP- binding
           protein domain - Clostridium oremlandii OhILAs
          Length = 631

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GI+I++    F+  S     IID PGH  FI+NM+ G S  D  +L+VAA  G
Sbjct: 38  GISIELGFTYFDLPSGKRAGIIDVPGHEKFIRNMLAGVSGMDIVLLVVAADEG 90


>UniRef50_A7CTC1 Cluster: Peptide chain release factor 3; n=2;
           Bacteria|Rep: Peptide chain release factor 3 -
           Opitutaceae bacterium TAV2
          Length = 544

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 28/110 (25%), Positives = 48/110 (43%)
 Frame = +1

Query: 145 VIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGI 324
           +I H D+GK+T T   +     I         K  +    D       W    L    GI
Sbjct: 15  IISHPDAGKTTLTEKFLLYGNAIHLAGTVTARKNQRATTSD-------WME--LEKQRGI 65

Query: 325 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           ++   + +F+   Y V ++D PGH+DF ++     +  D A++++ AG G
Sbjct: 66  SVSSTVLQFDYQGYAVNLLDTPGHKDFSEDTYRVLTAVDAALMVIDAGKG 115


>UniRef50_A7QC01 Cluster: Chromosome chr10 scaffold_76, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr10 scaffold_76, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 112

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
           G T+++    FE      TI+DA GH++ + NMI+  SQAD  +L+++A
Sbjct: 55  GKTVEVGRAHFEPEMTRFTILDASGHKNHVPNMISSASQADMGMLVISA 103


>UniRef50_P44910 Cluster: GTP-binding protein typA/bipA homolog;
           n=301; Bacteria|Rep: GTP-binding protein typA/bipA
           homolog - Haemophilus influenzae
          Length = 616

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 35/113 (30%), Positives = 48/113 (42%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +I HVD GK+T    L+ + G     T E    +  E V D ++         L   
Sbjct: 12  NIAIIAHVDHGKTTLVDKLLQQSG-----TFESARGDVDERVMDSND---------LEKE 57

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI         + Y + I+D PGH DF   +    S  D  +L+V A  G
Sbjct: 58  RGITILAKNTAINWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLVVDAFDG 110


>UniRef50_Q969S9-2 Cluster: Isoform 2 of Q969S9 ; n=8;
           Tetrapoda|Rep: Isoform 2 of Q969S9 - Homo sapiens
           (Human)
          Length = 732

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 34/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  ++Y  G         + +   + V D   +  +    R    
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGD-VDDGDTVTDFMAQER---E 118

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>UniRef50_A3SGF9 Cluster: Translation elongation factor,
           selenocysteine-specific; n=2; Sulfitobacter|Rep:
           Translation elongation factor, selenocysteine-specific -
           Sulfitobacter sp. EE-36
          Length = 623

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/52 (40%), Positives = 33/52 (63%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           G++I +     E +   + +IDAPGH DFI+ M++G S A  A+L+V+A  G
Sbjct: 38  GLSIALGFAHCEMAGGTLDLIDAPGHEDFIRTMVSGASGAQGAMLVVSAVEG 89


>UniRef50_A5KED2 Cluster: Elongation factor, putative; n=1;
           Plasmodium vivax|Rep: Elongation factor, putative -
           Plasmodium vivax
          Length = 833

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 16/36 (44%), Positives = 28/36 (77%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFE 240
           +NI+V+GH+D+GKST  G L+Y    + ++T++K+E
Sbjct: 118 LNILVLGHIDAGKSTLIGALLYNLSYVSEQTVKKYE 153



 Score = 33.1 bits (72), Expect = 7.3
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
           V I D PGH + + N+ T +  AD A+L+V A
Sbjct: 257 VNIFDTPGHNELVTNLHTWSFFADTAILVVDA 288


>UniRef50_A6SB62 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 774

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 36/122 (29%), Positives = 53/122 (43%), Gaps = 6/122 (4%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQEWVKDPS 273
           M K     N+ VI HVD GKST T  L+ K G I      D R  +    E +  +   S
Sbjct: 13  MDKATNVRNMSVIAHVDHGKSTLTDSLLSKAGIISAAKAGDARATDTRADEQERGITIKS 72

Query: 274 NMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 453
             +  + N  L     +  DI   K +   + + +ID+PGH DF   +       D A++
Sbjct: 73  TAISLYGN--LPDDEDLK-DIVGQKTDGRDFLINLIDSPGHVDFSSEVTAALRVTDGALV 129

Query: 454 IV 459
           +V
Sbjct: 130 VV 131


>UniRef50_Q02652 Cluster: Tetracycline resistance protein tetM; n=3;
           Streptomyces|Rep: Tetracycline resistance protein tetM -
           Streptomyces lividans
          Length = 639

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 34/114 (29%), Positives = 52/114 (45%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +NI ++ HVD+GK++ T  L++  G +D+               D   + G     R   
Sbjct: 4   LNIGILAHVDAGKTSLTERLLFDHGAVDRL--------GSVDAGDTRTVDGGIERRR--- 52

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             GITI  A+  F      V +ID PGH DF+  +       D AVL+++A  G
Sbjct: 53  --GITIRSAVAAFTVGDTRVNLIDTPGHSDFVAEVERALEVLDGAVLLLSAVEG 104


>UniRef50_Q5FLA9 Cluster: Peptide chain release factor 3; n=66;
           Bacteria|Rep: Peptide chain release factor 3 -
           Lactobacillus acidophilus
          Length = 523

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 32/122 (26%), Positives = 54/122 (44%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           K+ K +T     +I H D+GK+T T  ++   G I K    K  K       D       
Sbjct: 8   KVEKRRT---FAIISHPDAGKTTITEQMLLFGGVIRKAGTVKARKTGNFATSD------- 57

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
           W    +    GI++  ++ +FE     + I+D PGH+DF ++        D AV+++ + 
Sbjct: 58  WME--IEKKRGISVTSSVMQFEYKGKRINILDTPGHQDFSEDTYRTLMAVDSAVMVIDSA 115

Query: 469 TG 474
            G
Sbjct: 116 KG 117


>UniRef50_Q969S9 Cluster: Elongation factor G 2, mitochondrial
           precursor; n=40; Deuterostomia|Rep: Elongation factor G
           2, mitochondrial precursor - Homo sapiens (Human)
          Length = 779

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 34/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  ++Y  G         + +   + V D   +  +    R    
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG---------YTRSLGD-VDDGDTVTDFMAQER---E 118

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F+   Y V +ID PGH DF   +       D AV +  A  G
Sbjct: 119 RGITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAG 171


>UniRef50_Q6ML87 Cluster: PrfC protein; n=1; Bdellovibrio
           bacteriovorus|Rep: PrfC protein - Bdellovibrio
           bacteriovorus
          Length = 535

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 35/127 (27%), Positives = 60/127 (47%), Gaps = 3/127 (2%)
 Frame = +1

Query: 106 PKMGKE-KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNML 282
           P++ KE +      +I H D+GK+T T  L+Y  GG+   T E   K+  + V       
Sbjct: 5   PQIQKEIQRRRTFAIISHPDAGKTTLTEKLLYH-GGVIHETGEVKGKQGTKAVTSD---- 59

Query: 283 GYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKN--MITGTSQADCAVLI 456
             W    +    GI+I  ++  F+     V ++D PGH+DF ++   +    ++ C ++ 
Sbjct: 60  --WM--AMEREKGISITSSVMTFDFDGLRVNLLDTPGHKDFSEDTYRVLMAVESACMLID 115

Query: 457 VAAGTGE 477
           VA G  E
Sbjct: 116 VAKGVEE 122


>UniRef50_A2XIM0 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 311

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 37/124 (29%), Positives = 54/124 (43%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+DSGK+T T  ++Y  G I     E  E   ++ V    + +       L   
Sbjct: 70  NIGISAHIDSGKTTLTERVLYYTGRIH----EIHEVRGRDGVGAKMDSMD------LERE 119

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 495
            GITI  A      + Y V IID PGH DF   +       D A+L++ +  G     I+
Sbjct: 120 KGITIQSAATYCTWNGYQVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSIT 179

Query: 496 KNGQ 507
            + Q
Sbjct: 180 VDRQ 183


>UniRef50_Q8I568 Cluster: TetQ family GTPase, putative; n=1;
           Plasmodium falciparum 3D7|Rep: TetQ family GTPase,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 1161

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 31/117 (26%), Positives = 53/117 (45%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K  +NI ++ H+D+GK+T +  ++Y          +  E + +  + D +  L +    R
Sbjct: 22  KKLVNIGILAHIDAGKTTISEDILY----------QSKEIKVKGNINDQNTQLDFLKQER 71

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                GITI  A   FE +K  V +ID PGH DF           D  ++++ +  G
Sbjct: 72  ---ERGITIKSAYSCFEWNKIKVNLIDTPGHIDFSNETFISLCVLDKCIIVIDSKEG 125


>UniRef50_Q5FMW9 Cluster: Translation elongation factors; n=2;
           Lactobacillus|Rep: Translation elongation factors -
           Lactobacillus acidophilus
          Length = 639

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 34/114 (29%), Positives = 53/114 (46%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           I + ++ HVD+GK+T +  L+YK   I  RT+ + +           N   +     L  
Sbjct: 4   ITMGIVAHVDAGKTTLSEGLLYKADNI--RTLGRVD-----------NGDAFLDTDALEK 50

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           + GITI     K  T    +T++D PGH DF        S  D A+L+++A  G
Sbjct: 51  ARGITIFSHEAKLMTDNSDITLLDTPGHVDFAFQTEEILSVLDYAILVISASDG 104


>UniRef50_A5K8L7 Cluster: TetQ family GTPase, putative; n=1;
           Plasmodium vivax|Rep: TetQ family GTPase, putative -
           Plasmodium vivax
          Length = 1101

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 31/114 (27%), Positives = 53/114 (46%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +N+ ++ H+D+GK+T +  ++Y C           E + +  ++D +  L +    R   
Sbjct: 26  VNLGILAHIDAGKTTISEDILY-CAN---------EIKVKGSIQDQNTQLDFLRQER--- 72

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             GITI  A   F+ +   V +ID PGH DF          +D  V++V A  G
Sbjct: 73  ERGITIKTAYSCFKWNNVKVNLIDTPGHVDFSNETFLSLCVSDRCVIVVDAKEG 126


>UniRef50_Q8SQT7 Cluster: TRANSLATION ELONGATION FACTOR 2; n=3;
           Microsporidia|Rep: TRANSLATION ELONGATION FACTOR 2 -
           Encephalitozoon cuniculi
          Length = 850

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 34/121 (28%), Positives = 54/121 (44%), Gaps = 5/121 (4%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDK-----RTIEKFEKEAQEWVKDPSN 276
           M  +K   NI VI HVD GKST T  L+ K   + K     R ++  E E Q  +   S+
Sbjct: 13  MMNQKNIRNISVIAHVDHGKSTLTDCLVIKAKIVSKDSGGGRYMDSREDEQQRGITIKSS 72

Query: 277 MLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI 456
            +      +  V    T +        +++ + +ID+PGH DF   +       D A+++
Sbjct: 73  AISLHFQVQKDVLEAYTKE---GDTNGTEFLINLIDSPGHVDFSSEVTAALRVTDGALVV 129

Query: 457 V 459
           V
Sbjct: 130 V 130


>UniRef50_Q837X4 Cluster: Peptide chain release factor 3; n=47;
           Firmicutes|Rep: Peptide chain release factor 3 -
           Enterococcus faecalis (Streptococcus faecalis)
          Length = 524

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 33/123 (26%), Positives = 54/123 (43%)
 Frame = +1

Query: 145 VIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGI 324
           +I H D+GK+T T  L+   G I +    K +K       D       W    +    GI
Sbjct: 17  IISHPDAGKTTITEQLLLFGGAIRQAGTVKGKKTGNFAKSD-------WME--IEKQRGI 67

Query: 325 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNG 504
           ++  ++ +F+     + I+D PGH DF ++        D AV+++ +  G  EA   K  
Sbjct: 68  SVTSSVMQFDYQDKRINILDTPGHEDFSEDTYRTLMAVDSAVMVIDSAKG-IEAQTKKLF 126

Query: 505 QTV 513
           Q V
Sbjct: 127 QVV 129


>UniRef50_Q73R08 Cluster: Elongation factor G 1; n=2; Treponema|Rep:
           Elongation factor G 1 - Treponema denticola
          Length = 683

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 31/113 (27%), Positives = 48/113 (42%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  +++  G I K       +   +W+    +             
Sbjct: 7   NIGIMAHIDAGKTTTTERILFYTGKIHKIGEIDDGQATMDWMAQEQDR------------ 54

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A        + + IID PGH DF   +       D AV ++ A  G
Sbjct: 55  -GITIQSAATTTYWKNFQINIIDTPGHVDFTAEVERSLRVLDGAVAVLCAVGG 106


>UniRef50_Q8I335 Cluster: GTP-binding protein, putative; n=1;
           Plasmodium falciparum 3D7|Rep: GTP-binding protein,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 1085

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 35/119 (29%), Positives = 50/119 (42%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           KEK   N  ++ H+DSGKST     +     I K       K  QE   D   M+     
Sbjct: 230 KEKYIRNFCILAHIDSGKSTLADRFLELTNTIKK-------KRMQEQFLD---MMC---- 275

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             L    GITI +   +   + Y   +ID PGH DF   +    +  + A+L++  G G
Sbjct: 276 --LEREKGITIKLKAVRMHYNNYVFNLIDTPGHFDFYHEVKRSLNVCEGAILLIDGGKG 332


>UniRef50_P39677 Cluster: Elongation factor G 2, mitochondrial
           precursor; n=6; Saccharomycetales|Rep: Elongation factor
           G 2, mitochondrial precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 819

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 36/114 (31%), Positives = 52/114 (45%), Gaps = 1/114 (0%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +I H+D+GK+TTT  ++Y  G I K   +         V     +  +    R   S
Sbjct: 43  NIGIIAHIDAGKTTTTERMLYYAG-ISKHIGD---------VDTGDTITDFLEQER---S 89

Query: 316 VGITIDIALWKFE-TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F   + + + +ID PGH DF   +I      D  V+I+ A  G
Sbjct: 90  RGITIQSAAISFPWRNTFAINLIDTPGHIDFTFEVIRALKVIDSCVVILDAVAG 143


>UniRef50_UPI0000E46328 Cluster: PREDICTED: similar to G elongation
           factor, mitochondrial 2; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to G elongation
           factor, mitochondrial 2 - Strongylocentrotus purpuratus
          Length = 699

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 34/113 (30%), Positives = 48/113 (42%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  ++Y  G     T           V D   +  Y    R    
Sbjct: 15  NIGILAHIDAGKTTTTERMLYYSG-----TTRHLGD-----VDDGDTVTDYMPQER---D 61

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F    + + +ID PGH DF   +       D AV ++ A  G
Sbjct: 62  RGITITSAAVTFPWKNHRINLIDTPGHVDFTMEVERCLRVLDGAVTVLDASAG 114


>UniRef50_Q8XIK3 Cluster: Selenocysteine-specific elongation factor;
           n=8; Clostridia|Rep: Selenocysteine-specific elongation
           factor - Clostridium perfringens
          Length = 635

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GI+I++    F+  S     IID PGH  FIKNM+ G +  D  +LI+A   G
Sbjct: 38  GISINLGFTFFDLPSGKRAGIIDVPGHEKFIKNMLAGATSLDVVLLIIALDEG 90


>UniRef50_Q1NNQ3 Cluster: Small GTP-binding protein domain; n=4;
           Bacteria|Rep: Small GTP-binding protein domain - delta
           proteobacterium MLMS-1
          Length = 702

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 37/133 (27%), Positives = 63/133 (47%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           K+  +K   NIV++G V SGK+T    ++++  G+ KR         +  V+D + +  Y
Sbjct: 2   KLYDDKYIKNIVLLGSVKSGKTTLAETMVFE-SGLSKR---------RGAVEDKNTISDY 51

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                +    G ++   L   +   + + IID PG  DF+  +I+    AD AV+++ A 
Sbjct: 52  H---EIEHERGNSVYATLLHTDWRDFKINIIDTPGLDDFVGEVISALRVADTAVMLINAP 108

Query: 469 TGEFEAGISKNGQ 507
            G  E G   N Q
Sbjct: 109 YG-VEVGTELNWQ 120


>UniRef50_Q18YZ1 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Desulfitobacterium
           hafniense|Rep: Selenocysteine-specific translation
           elongation factor - Desulfitobacterium hafniense (strain
           DCB-2)
          Length = 634

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           G+TI++        S   V+IID PGH  F+K M+ G +  D  +L++AA  G
Sbjct: 38  GMTIELGFASLTLPSGQIVSIIDVPGHEKFVKTMVAGVTGIDLVMLVIAADEG 90


>UniRef50_Q4Q2R0 Cluster: Selenocysteine-specific elongation factor,
           putative; n=3; Leishmania|Rep: Selenocysteine-specific
           elongation factor, putative - Leishmania major
          Length = 678

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 34/116 (29%), Positives = 53/116 (45%), Gaps = 1/116 (0%)
 Frame = +1

Query: 130 HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLS 309
           ++NI ++GHVDSGK+     L          +   F+K  Q   +  +  LG+ +   +S
Sbjct: 3   NVNIGLLGHVDSGKTALAKALS------STASTAAFDKSPQSQSRGITLDLGF-SACEVS 55

Query: 310 VSVGIT-IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           V  G       L   E +K   T++D PGH   I+ ++ G    D  VL+V A  G
Sbjct: 56  VEDGNEDATQVLRAAELTKVQCTLVDCPGHASLIRTVVGGAQIIDAMVLVVDATKG 111


>UniRef50_Q2RJM5 Cluster: Translation initiation factor IF-2; n=3;
           Bacteria|Rep: Translation initiation factor IF-2 -
           Moorella thermoacetica (strain ATCC 39073)
          Length = 903

 Score = 39.9 bits (89), Expect(2) = 0.008
 Identities = 21/61 (34%), Positives = 28/61 (45%)
 Frame = +1

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
           TN   S + GIT  I  ++       +T +D PGH  F      G    D A+L+VAA  
Sbjct: 428 TNVTASEAGGITQHIGAYQVRLKNRKITFLDTPGHAAFTAMRARGAQATDIAILVVAADD 487

Query: 472 G 474
           G
Sbjct: 488 G 488



 Score = 22.2 bits (45), Expect(2) = 0.008
 Identities = 9/24 (37%), Positives = 17/24 (70%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKST 177
           P+  +E+  + + V+GHVD GK++
Sbjct: 398 PETLRERPPV-VTVMGHVDHGKTS 420


>UniRef50_UPI0000D56919 Cluster: PREDICTED: similar to CG31159-PA;
           n=2; Endopterygota|Rep: PREDICTED: similar to CG31159-PA
           - Tribolium castaneum
          Length = 714

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 30/113 (26%), Positives = 48/113 (42%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  ++Y  G I++           +++                  
Sbjct: 37  NIGILAHIDAGKTTTTERMLYYSGLINQMGEVHHGNTVTDFMDQERER------------ 84

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F    Y   +ID PGH DF   +    +  D AV+++    G
Sbjct: 85  -GITITSAAVTFYWKNYQFNLIDTPGHIDFTMEVEQTLNVLDGAVVVLDGSAG 136


>UniRef50_Q931D5 Cluster: SelB selenocysteine-specific elongation
           factor; n=4; Alphaproteobacteria|Rep: SelB
           selenocysteine-specific elongation factor - Rhizobium
           meliloti (Sinorhizobium meliloti)
          Length = 666

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVT-IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GITID+       +K  VT  +D PGH  FI  M+ G    D A+L+VAA  G
Sbjct: 35  GITIDLGFAYARFAKDAVTGFVDVPGHERFIHTMLAGAGGIDYAMLVVAADDG 87


>UniRef50_Q3E0L1 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=1; Chloroflexus aurantiacus J-10-fl|Rep:
           Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain - Chloroflexus aurantiacus J-10-fl
          Length = 622

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
 Frame = +1

Query: 322 ITIDIAL-WKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
           +TID+   W        V++ID PGH  FIKNM+ G    D  +L++AA
Sbjct: 43  MTIDLGFAWLTLPGGREVSLIDVPGHERFIKNMLAGVGGIDAVLLVIAA 91


>UniRef50_Q2B7L6 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Bacillus sp. NRRL B-14911|Rep:
           Selenocysteine-specific translation elongation factor -
           Bacillus sp. NRRL B-14911
          Length = 618

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 18/42 (42%), Positives = 25/42 (59%)
 Frame = +1

Query: 349 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +E     V++ID PGH  FI+ MI G +  D  +L+VAA  G
Sbjct: 42  YEDEDLEVSVIDVPGHERFIRQMIAGVAGIDLVILVVAADEG 83


>UniRef50_A6BIM9 Cluster: Putative uncharacterized protein; n=1;
           Dorea longicatena DSM 13814|Rep: Putative
           uncharacterized protein - Dorea longicatena DSM 13814
          Length = 637

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GITID+    F+        I+D PGH  FI NM+ G    D  +L++AA  G
Sbjct: 38  GITIDLGFTYFDLPGGDRAGIVDVPGHEKFINNMVAGVVGMDLVLLVIAADEG 90


>UniRef50_A7PFT2 Cluster: Chromosome chr11 scaffold_14, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr11 scaffold_14, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 247

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 19/31 (61%), Positives = 24/31 (77%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSE 602
           REHALLA  LGV+Q+I   NKM++T P YS+
Sbjct: 100 REHALLALILGVRQMICCCNKMEATTPKYSK 130


>UniRef50_Q384D0 Cluster: Elongation factor G2-like protein; n=5;
           Trypanosoma|Rep: Elongation factor G2-like protein -
           Trypanosoma brucei
          Length = 824

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 28/113 (24%), Positives = 49/113 (43%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  +++  G + +           +++K+              + 
Sbjct: 67  NIGIVAHIDAGKTTTTERMLFYAGAVKRVGDVDSGTTTMDFMKE-------------EMD 113

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F+   + + +ID PGH DF   +       D  V +  A  G
Sbjct: 114 RGITIQSAAVSFQWRGHSIHLIDTPGHVDFTVEVERAMRVVDGVVALFDASAG 166


>UniRef50_A0D5J3 Cluster: Chromosome undetermined scaffold_39, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_39,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 784

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 36/123 (29%), Positives = 53/123 (43%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           P   +EK   N  +I H+D+GK+TTT  +++  G I       F  E    V D +  + 
Sbjct: 32  PTTTEEKIR-NFGIIAHIDAGKTTTTERMLFYSGAI------TFPGE----VHDGTTTMD 80

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
           +    R     GITI  A   F  + +   +ID PGH DF   +       D A+ I   
Sbjct: 81  FMPQER---QRGITIRSAAISFNWANHQYNLIDTPGHIDFTAEVERSLRVLDGAIAIFDG 137

Query: 466 GTG 474
            +G
Sbjct: 138 VSG 140


>UniRef50_A3LWR2 Cluster: Mitochondrial elongation factor G-like
           protein; n=2; Pichia|Rep: Mitochondrial elongation
           factor G-like protein - Pichia stipitis (Yeast)
          Length = 845

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 34/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +I H+D+GK+TTT  ++Y  G        K ++     V +   +  Y  + R    
Sbjct: 42  NIGIIAHIDAGKTTTTERMLYYSG--------KTKRIGN--VDEGDTVTDYLPSER---Q 88

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A      + + + IID PGH DF   +       D AV I+    G
Sbjct: 89  RGITIQSAAISIPWNNHKINIIDTPGHADFTFEVTRSLRVLDGAVTILDGVAG 141


>UniRef50_UPI000050FBE9 Cluster: COG3276: Selenocysteine-specific
           translation elongation factor; n=1; Brevibacterium
           linens BL2|Rep: COG3276: Selenocysteine-specific
           translation elongation factor - Brevibacterium linens
           BL2
          Length = 607

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIAL-WKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           G+TID+   W    S   +  +D PGH  F+ NM+ G   A    L+VAA  G
Sbjct: 39  GLTIDLGFAWTTLPSGRELAFVDVPGHEKFLANMLAGVGPAPIVCLVVAADKG 91


>UniRef50_Q1GFM6 Cluster: Peptide chain release factor 3; n=41;
           Proteobacteria|Rep: Peptide chain release factor 3 -
           Silicibacter sp. (strain TM1040)
          Length = 562

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 28/123 (22%), Positives = 52/123 (42%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           P++ + +T     +I H D+GK+T T   +   G I      + + EA+    D   M  
Sbjct: 40  PEIARRRT---FAIISHPDAGKTTLTEKFLLYGGAIQMAGQVRAKGEARRTRSDFMQM-- 94

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
                      GI++  +   F+   +   ++D PGH DF ++     +  D AV+++  
Sbjct: 95  -------EKDRGISVSASAMSFDYGDFRYNLVDTPGHSDFSEDTYRTLTAVDAAVMVIDG 147

Query: 466 GTG 474
             G
Sbjct: 148 AKG 150


>UniRef50_A7HB64 Cluster: Translation elongation factor G; n=2;
           Anaeromyxobacter|Rep: Translation elongation factor G -
           Anaeromyxobacter sp. Fw109-5
          Length = 689

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 32/113 (28%), Positives = 48/113 (42%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+T T  L++  G   K           +W++             L   
Sbjct: 20  NIGIMAHIDAGKTTLTERLLFVAGRTHKMGEVHDGLAVMDWME-------------LERE 66

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A+  FE   + + +ID PGH DF   +       D AV +  A  G
Sbjct: 67  RGITITSAVTSFEWRGHELHLIDTPGHVDFTIEVERSLRVLDGAVAVFDAAHG 119


>UniRef50_A4X2G5 Cluster: Selenocysteine-specific translation
           elongation factor; n=3; Actinomycetales|Rep:
           Selenocysteine-specific translation elongation factor -
           Salinispora tropica CNB-440
          Length = 604

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIAL-WKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           G+TID+   W    +++    +D PGH+ F+ NM+ G       + +VAA  G
Sbjct: 36  GMTIDLGFAWTTLDNEHMTAFVDVPGHQRFVSNMLAGVGPVTAVLFVVAADEG 88


>UniRef50_A0KL71 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Aeromonas|Rep:
           Selenocysteine-specific translation elongation factor -
           Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966
           / NCIB 9240)
          Length = 627

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = +1

Query: 313 SVGITIDIALWKFETSK-YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           ++G+T D+    F+  +   + +ID PGH  +I+NM+ G    D  +L++AA  G
Sbjct: 37  AIGMTQDLGFAHFDDGQGNTIGVIDVPGHERYIRNMVAGLWSLDLVLLVIAADEG 91


>UniRef50_Q9VCX4 Cluster: CG31159-PA; n=4; Diptera|Rep: CG31159-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 692

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 33/117 (28%), Positives = 53/117 (45%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI ++ H+D+GK+TTT  +++  G          +  A   V   + +  Y T  R    
Sbjct: 35  NIGILAHIDAGKTTTTERMLFYAG----------KTRALGEVHRGNTVTDYLTQER---E 81

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 486
            GITI  +   F  + + + ++D PGH DF   +       D  V++V  GT   EA
Sbjct: 82  RGITICSSAVTFSWNDHRINLLDTPGHIDFTMEVEQSLYAVD-GVVVVLDGTAGVEA 137


>UniRef50_Q96RP9 Cluster: Elongation factor G 1, mitochondrial
           precursor; n=52; cellular organisms|Rep: Elongation
           factor G 1, mitochondrial precursor - Homo sapiens
           (Human)
          Length = 751

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 35/113 (30%), Positives = 46/113 (40%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+DSGK+T T  ++Y  G I K             VK    +     +  L   
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK----------MHEVKGKDGVGAVMDSMELERQ 97

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A          + IID PGH DF   +       D AVL++ A  G
Sbjct: 98  RGITIQSAATYTMWKDVNINIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGG 150


>UniRef50_A5D2S0 Cluster: Translation initiation factor 2; n=5;
           Clostridiales|Rep: Translation initiation factor 2 -
           Pelotomaculum thermopropionicum SI
          Length = 973

 Score = 39.5 bits (88), Expect(2) = 0.013
 Identities = 21/61 (34%), Positives = 30/61 (49%)
 Frame = +1

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
           TN   + + GIT  I  ++ E +   +T +D PGH  F      G    D A+L+VAA  
Sbjct: 497 TNVTATEAGGITQHIGAYQVEHNGKKITFLDTPGHEAFTAMRARGARVTDIAILVVAADD 556

Query: 472 G 474
           G
Sbjct: 557 G 557



 Score = 21.8 bits (44), Expect(2) = 0.013
 Identities = 7/13 (53%), Positives = 11/13 (84%)
 Frame = +1

Query: 139 IVVIGHVDSGKST 177
           + V+GHVD GK++
Sbjct: 477 VTVMGHVDHGKTS 489


>UniRef50_Q6G589 Cluster: Peptide chain release factor 3; n=14;
           Alphaproteobacteria|Rep: Peptide chain release factor 3
           - Bartonella henselae (Rochalimaea henselae)
          Length = 525

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 28/117 (23%), Positives = 50/117 (42%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*R 303
           K      +I H D+GK+T T  L+   G I      K +K+  +   D       W +  
Sbjct: 9   KRRRTFAIIAHPDAGKTTLTEKLLLFGGAIQLAGEVKAKKDRIQTRSD-------WMH-- 59

Query: 304 LSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +    GI++  ++  FE   +   ++D PGH DF  +     +  D A++++    G
Sbjct: 60  IERDRGISVVTSVMTFEYEDHIFNLLDTPGHEDFADDTYRTLTAVDSAIMVLDGARG 116


>UniRef50_Q6AKJ8 Cluster: Probable elongation factor G; n=1;
           Desulfotalea psychrophila|Rep: Probable elongation
           factor G - Desulfotalea psychrophila
          Length = 685

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 31/113 (27%), Positives = 56/113 (49%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NIV++GH + GK++    L+Y  G I++  + K        V D S ++ Y         
Sbjct: 9   NIVIVGHGNCGKTSLAEALLYTSGKINR--LGK--------VDDGSAVMDYDAE---ETG 55

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GI+I+     +  +K++V + DAPG  +F+   +  T+ +D A+  + A  G
Sbjct: 56  RGISINTGFHNYLWNKHHVFLADAPGDDNFLNEALFTTNVSDGALFTIGAILG 108


>UniRef50_Q2LU53 Cluster: Selenocysteine-specific protein
           translation Elongation Factor; n=1; Syntrophus
           aciditrophicus SB|Rep: Selenocysteine-specific protein
           translation Elongation Factor - Syntrophus
           aciditrophicus (strain SB)
          Length = 636

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVT-IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GITI++           +  ++D PGH  F+KNM+ G +  D  ++++AA  G
Sbjct: 38  GITIELGFASLRLRNGQICGVVDVPGHERFVKNMVAGAAGIDMVLMVIAADEG 90


>UniRef50_A5ZXF5 Cluster: Putative uncharacterized protein; n=2;
           Clostridiales|Rep: Putative uncharacterized protein -
           Ruminococcus obeum ATCC 29174
          Length = 926

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 32/107 (29%), Positives = 47/107 (43%)
 Frame = +1

Query: 139 IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSV 318
           I ++ HVD+GK+T +  L+Y CG I  R I + +               +     L    
Sbjct: 6   IGILAHVDAGKTTLSEELLYLCGEI--RKIGRVDHGD-----------AFLDTYELEKER 52

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 459
           GITI       +T    VT++D PGH DF   M       D A+L++
Sbjct: 53  GITIFSKQALLKTENMEVTLLDTPGHVDFSAEMERTLQVLDYAILVI 99


>UniRef50_Q55G92 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 765

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 38/128 (29%), Positives = 58/128 (45%), Gaps = 2/128 (1%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +I HVD+GK+TT   ++Y   G+ KR  E         V     ++ Y    +L   
Sbjct: 41  NIGIIAHVDAGKTTTCERMLY-YSGLIKRIGE---------VHKGDTIMDYM---KLERE 87

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE--AG 489
            GITI  A      + + + I+D PGH DF       T + + +V ++  G   F+  AG
Sbjct: 88  RGITIGAATVTIPWNDHRINIVDTPGHVDF-------TVEVERSVRVIDGGVAIFDGVAG 140

Query: 490 ISKNGQTV 513
           +     TV
Sbjct: 141 VQAQSITV 148


>UniRef50_Q4Y0B9 Cluster: TetQ family GTPase, putative; n=5;
           Plasmodium (Vinckeia)|Rep: TetQ family GTPase, putative
           - Plasmodium chabaudi
          Length = 980

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 29/114 (25%), Positives = 50/114 (43%)
 Frame = +1

Query: 133 INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSV 312
           +N+ ++ H+D+GK+T +  ++Y    I            +  + D +  L +    R   
Sbjct: 25  VNLGILAHIDAGKTTISEDILYNSNEI----------RVKGNINDQNTQLDFLKQER--- 71

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             GITI  A   F+ +   V +ID PGH DF          +D  V+++ A  G
Sbjct: 72  ERGITIKTAYSCFKWNNVNVNLIDTPGHIDFSNETFLSLCVSDKCVIVIDAKEG 125


>UniRef50_Q22A26 Cluster: Elongation factor Tu GTP binding domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu GTP binding domain
           containing protein - Tetrahymena thermophila SB210
          Length = 728

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 7/120 (5%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCG-----GIDKRTIEKFEKEAQEWVK--DPSNMLGYWT 294
           N+ +I HVD GK+T    L+   G      +D   +E+ +++ Q   K      +  +++
Sbjct: 90  NVAIIAHVDHGKTTLVDTLLKTSGLEHDKSMDSNQLEQEKEDIQYLPKIYHGQQLKSFFS 149

Query: 295 N*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           N R  V+ G+T            Y + I+D PGH DF   +    S  D  +L+V A  G
Sbjct: 150 NNRSKVT-GVTF---------KDYKINIVDTPGHHDFGGEVERIMSMVDGVILLVCATEG 199


>UniRef50_A7AQT2 Cluster: Elongation factor G 2, mitochondrial,
           putative; n=1; Babesia bovis|Rep: Elongation factor G 2,
           mitochondrial, putative - Babesia bovis
          Length = 537

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 29/113 (25%), Positives = 50/113 (44%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +I H+D+GK+T    LI           +   K  +  + + S  L +       + 
Sbjct: 8   NIGIIAHIDAGKTTLAEALI-----------DLANKREERNIANSSIQLDFMEQ---EIK 53

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
            GITI  A   F+ +  ++ +ID PGH DF   +I+     D  ++++    G
Sbjct: 54  RGITIRAACSSFKWNGCHINVIDTPGHTDFSGEVISAMDVIDGCIIVIDGTKG 106


>UniRef50_Q7URR0 Cluster: Translation initiation factor IF-2; n=1;
           Pirellula sp.|Rep: Translation initiation factor IF-2 -
           Rhodopirellula baltica
          Length = 1038

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 21/52 (40%), Positives = 27/52 (51%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           GIT  I  +K +     VT +D PGH  F +    G +  D AVL+VAA  G
Sbjct: 563 GITQHIRAYKIDKDGRAVTFVDTPGHEAFTEMRARGANVTDIAVLVVAADDG 614


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 747,569,222
Number of Sequences: 1657284
Number of extensions: 14915662
Number of successful extensions: 48460
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 45307
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 48137
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 59677054775
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -