SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30149.Seq
         (867 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000D577BE Cluster: PREDICTED: similar to CG13035-PA...    75   2e-12
UniRef50_Q8IQN7 Cluster: CG13035-PB, isoform B; n=3; Sophophora|...    73   7e-12
UniRef50_Q7Q0B2 Cluster: ENSANGP00000011229; n=2; Culicidae|Rep:...    70   7e-11
UniRef50_UPI00015B62DE Cluster: PREDICTED: similar to conserved ...    62   2e-08
UniRef50_Q18H13 Cluster: Homolog to NADH dehydrogenase, subunit ...    36   1.8  
UniRef50_Q3IKJ5 Cluster: Putative uncharacterized protein; n=2; ...    35   2.3  
UniRef50_A5ZT38 Cluster: Putative uncharacterized protein; n=1; ...    35   2.3  
UniRef50_Q2GUV2 Cluster: Putative uncharacterized protein; n=1; ...    35   3.1  
UniRef50_Q92EJ0 Cluster: Lin0469 protein; n=12; Listeria|Rep: Li...    33   9.4  

>UniRef50_UPI0000D577BE Cluster: PREDICTED: similar to CG13035-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG13035-PA, isoform A - Tribolium castaneum
          Length = 548

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 34/64 (53%), Positives = 46/64 (71%), Gaps = 1/64 (1%)
 Frame = +2

Query: 308 GPV-WDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEFLA 484
           GP+ W +  + KAA +L +PP    F+DEQEMR VY++IYDVFR+K VL QA++DI F  
Sbjct: 117 GPITWTVSDISKAACILAQPPAPTTFDDEQEMRRVYTLIYDVFRHKNVLTQALNDIAFFH 176

Query: 485 DYPQ 496
            YP+
Sbjct: 177 FYPE 180


>UniRef50_Q8IQN7 Cluster: CG13035-PB, isoform B; n=3;
           Sophophora|Rep: CG13035-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 739

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 43/148 (29%), Positives = 71/148 (47%)
 Frame = +2

Query: 308 GPVWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEFLAD 487
           G  W +  +  AA+LL KPP  VDF++E EMR  +S+IYDVFRYK V+  A+ D+ F  +
Sbjct: 116 GARWTLPTIANAAKLLRKPPILVDFQNEHEMRLAFSLIYDVFRYKVVMSNALADVSFFEE 175

Query: 488 YPQYTGNVT*FGYS*WS*RDVAGRPDQGQSKNALHNYWKALDNHLRKWRTLSGKQRVHFX 667
           + +   +        +   D   +    + K+     +K  ++ + +   L  + R+   
Sbjct: 176 HTELKNDEQRIWLMLFELYDRQFKGRNSEEKDLQARLYK--ESEVTELADLLWQHRIRLA 233

Query: 668 XXXXXXXXKNXALSLSDLLPPHCVRERI 751
                   +  AL LS LLP H   E++
Sbjct: 234 ASISRMRIQVGALRLSQLLPIHLQNEKV 261


>UniRef50_Q7Q0B2 Cluster: ENSANGP00000011229; n=2; Culicidae|Rep:
           ENSANGP00000011229 - Anopheles gambiae str. PEST
          Length = 667

 Score = 70.1 bits (164), Expect = 7e-11
 Identities = 31/66 (46%), Positives = 43/66 (65%)
 Frame = +2

Query: 317 WDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEFLADYPQ 496
           W +  +++A +LL +PP  V F+DE EMR VYS+IYDV+R+K VL QA+ +I F   YP 
Sbjct: 121 WRLEDIVRAGKLLHQPPLPVQFDDEYEMRKVYSMIYDVYRFKLVLQQALRNIGFYESYPM 180

Query: 497 YTGNVT 514
                T
Sbjct: 181 LAHETT 186


>UniRef50_UPI00015B62DE Cluster: PREDICTED: similar to conserved
           hypothetical protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to conserved hypothetical protein -
           Nasonia vitripennis
          Length = 853

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 27/56 (48%), Positives = 38/56 (67%)
 Frame = +2

Query: 311 PVWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEF 478
           P W +  +L AARLL    +  D+ DE EMR V+ ++YDV RYK +LD+A+DD+ F
Sbjct: 172 PGWRLRDILLAARLLMNERELDDYADEAEMRRVFGLVYDVLRYKQILDRALDDVGF 227


>UniRef50_Q18H13 Cluster: Homolog to NADH dehydrogenase, subunit L;
           n=1; Haloquadratum walsbyi DSM 16790|Rep: Homolog to
           NADH dehydrogenase, subunit L - Haloquadratum walsbyi
           (strain DSM 16790)
          Length = 528

 Score = 35.5 bits (78), Expect = 1.8
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)
 Frame = -3

Query: 532 SGIAKLCDVAGVLWVVSQELNIVHGLVQDTF-ISENVINNRI-NETHFLFVLEIDL 371
           +GIA + ++ GV   V  EL I HG+V   F IS  VI   I   +H L+VL +++
Sbjct: 455 AGIASIMEIGGVTPAVPTELTIAHGIVAGGFLISYVVIETEIYRRSHRLYVLLMNI 510


>UniRef50_Q3IKJ5 Cluster: Putative uncharacterized protein; n=2;
           Alteromonadales|Rep: Putative uncharacterized protein -
           Pseudoalteromonas haloplanktis (strain TAC 125)
          Length = 191

 Score = 35.1 bits (77), Expect = 2.3
 Identities = 25/100 (25%), Positives = 43/100 (43%), Gaps = 2/100 (2%)
 Frame = +3

Query: 258 CLRRILMHHHRFPLKLP-AQFGTSDRS*KRLVFSASHHSKSISRTNKKCVSFILLFMTFS 434
           C R I +HHH   + LP  +F  SD + +       H   +I+ +N K    + L+ T +
Sbjct: 48  CKRPIYLHHHPGEICLPGGKFEASDITLRTTALRELHEELNITPSNVKVFGQLPLYSTLT 107

Query: 435 DINVS-WTRPWTILSSWLTTHSTPATSHSLAIPDGVSETS 551
             N+S +       + W   H+    S  L + D  +E +
Sbjct: 108 GFNISPFVGMLNKHTIWENDHNEVQASFLLPLRDLTNEAN 147


>UniRef50_A5ZT38 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus obeum ATCC 29174|Rep: Putative
           uncharacterized protein - Ruminococcus obeum ATCC 29174
          Length = 444

 Score = 35.1 bits (77), Expect = 2.3
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
 Frame = -1

Query: 843 EIFLPSNA--IFLALKRVNPNPXIMAXNGHTLIMRSLTQ 733
           E+ LP N   +F A+K VNPN  ++  NGH L++  L++
Sbjct: 203 ELSLPENQMELFCAVKTVNPNVAVVLFNGHPLLLDELSR 241


>UniRef50_Q2GUV2 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 993

 Score = 34.7 bits (76), Expect = 3.1
 Identities = 19/52 (36%), Positives = 28/52 (53%)
 Frame = -1

Query: 834 LPSNAIFLALKRVNPNPXIMAXNGHTLIMRSLTQCGGNRSDNERAXFFIRIL 679
           LP+NA+FLA + + P   I   N  + I R + + GG RS N  +  F  +L
Sbjct: 68  LPTNALFLAAEEILPRHGIDPENTPSHIARLIFKIGGQRSGNTLSDKFRSVL 119


>UniRef50_Q92EJ0 Cluster: Lin0469 protein; n=12; Listeria|Rep:
           Lin0469 protein - Listeria innocua
          Length = 721

 Score = 33.1 bits (72), Expect = 9.4
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = +3

Query: 402 VSFILLFMTFSDINVSWTRPWTILSSWLTTHSTPATSHSLAIPDGVSETSL 554
           VS++ +  TF+D N +W    T+L  +L  H   A S  +A P+ +S  SL
Sbjct: 144 VSYLAVINTFTDYNSNWAIVRTVLEGFLLLHL--ALSSRIASPNRISADSL 192


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 824,276,936
Number of Sequences: 1657284
Number of extensions: 16460102
Number of successful extensions: 42102
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 40414
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42092
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 77062818868
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -