SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30147.Seq
         (878 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q05639 Cluster: Elongation factor 1-alpha 2; n=8397; ro...   280   4e-74
UniRef50_UPI00005A4635 Cluster: PREDICTED: similar to statin-lik...   215   9e-55
UniRef50_Q5EMT9 Cluster: Elongation factor 1-alpha-like protein;...   215   2e-54
UniRef50_Q2U0M0 Cluster: Translation elongation factor EF-1 alph...   202   9e-51
UniRef50_P13905 Cluster: Elongation factor 1-alpha; n=2224; cell...   202   1e-50
UniRef50_UPI0000E47BF2 Cluster: PREDICTED: similar to elongation...   178   2e-43
UniRef50_P35021 Cluster: Elongation factor 1-alpha; n=53; cellul...   146   5e-34
UniRef50_O93729 Cluster: Elongation factor 1-alpha; n=20; Archae...   144   2e-33
UniRef50_UPI0000EB0538 Cluster: UPI0000EB0538 related cluster; n...   144   3e-33
UniRef50_Q9Y450 Cluster: HBS1-like protein; n=43; Euteleostomi|R...   142   1e-32
UniRef50_A7RM15 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...   141   2e-32
UniRef50_Q96TP0 Cluster: Elongation factor 1 alpha; n=5; Fungi/M...   137   4e-31
UniRef50_Q5UHI3 Cluster: EF-1 alpha-like protein; n=6; Eukaryota...   135   1e-30
UniRef50_Q96TK8 Cluster: Translation elongation factor 1 alpha; ...   135   2e-30
UniRef50_P90922 Cluster: Putative uncharacterized protein; n=3; ...   134   2e-30
UniRef50_A5X901 Cluster: Elongation factor 1-alpha; n=2; Chilodo...   134   4e-30
UniRef50_Q2ABX8 Cluster: Elongation factor 1-alpha; n=1; Megacop...   133   5e-30
UniRef50_P15170 Cluster: G1 to S phase transition protein 1 homo...   131   2e-29
UniRef50_UPI0000D55B6A Cluster: PREDICTED: similar to CG1898-PA;...   130   3e-29
UniRef50_A6RVA8 Cluster: Putative uncharacterized protein; n=1; ...   130   3e-29
UniRef50_P50257 Cluster: Elongation factor 1-alpha S; n=1; Porph...   130   5e-29
UniRef50_UPI00006CC36B Cluster: Elongation factor Tu C-terminal ...   129   1e-28
UniRef50_A2AX44 Cluster: Translation elongation factor 1 like; n...   128   2e-28
UniRef50_A5JHE1 Cluster: Translation elongation factor EF-1 alph...   127   3e-28
UniRef50_Q259E7 Cluster: H0801D08.2 protein; n=5; Oryza sativa|R...   126   6e-28
UniRef50_Q5KLM5 Cluster: Putative uncharacterized protein; n=2; ...   125   1e-27
UniRef50_Q4P6P7 Cluster: Putative uncharacterized protein; n=1; ...   124   2e-27
UniRef50_A7D4X8 Cluster: Translation elongation factor EF-1, sub...   124   2e-27
UniRef50_Q23TC1 Cluster: Elongation factor Tu C-terminal domain ...   122   1e-26
UniRef50_A2QW82 Cluster: Contig An11c0160, complete genome; n=8;...   120   4e-26
UniRef50_Q8IIC9 Cluster: Translation elongation factor EF-1, sub...   120   6e-26
UniRef50_Q7YZN7 Cluster: Hsp70 subfamily B suppressor 1; n=3; Di...   119   9e-26
UniRef50_A6RA16 Cluster: Putative uncharacterized protein; n=1; ...   119   1e-25
UniRef50_O45622 Cluster: Putative uncharacterized protein; n=2; ...   118   1e-25
UniRef50_Q9NCN7 Cluster: Eukaryotic release factor 3 GTPase subu...   116   6e-25
UniRef50_Q6BVD7 Cluster: Similar to sp|P32769 Saccharomyces cere...   116   6e-25
UniRef50_A3LY56 Cluster: Predicted protein; n=2; Pichia|Rep: Pre...   116   1e-24
UniRef50_UPI0000DD78A4 Cluster: PREDICTED: similar to statin-lik...   115   1e-24
UniRef50_A4ZCD1 Cluster: GTP-binding protein; n=9; Magnoliophyta...   115   1e-24
UniRef50_Q96WS7 Cluster: Eukaryotic release factor 3; n=1; Pneum...   115   1e-24
UniRef50_Q9NCN8 Cluster: Eukaryotic release factor 3 GTPase subu...   115   2e-24
UniRef50_Q9HGI4 Cluster: Eukaryotic peptide chain release factor...   113   4e-24
UniRef50_P05453 Cluster: Eukaryotic peptide chain release factor...   113   4e-24
UniRef50_A4R2K6 Cluster: Putative uncharacterized protein; n=1; ...   113   6e-24
UniRef50_UPI0000499ED8 Cluster: guanine nucleotide regulatory pr...   113   7e-24
UniRef50_Q00WU5 Cluster: EF-1 alpha-like protein; n=1; Ostreococ...   112   1e-23
UniRef50_Q86NR4 Cluster: RE29053p; n=5; Diptera|Rep: RE29053p - ...   112   1e-23
UniRef50_O74718 Cluster: Eukaryotic peptide chain release factor...   111   2e-23
UniRef50_Q4QGW5 Cluster: Eukaryotic release factor 3, putative; ...   111   2e-23
UniRef50_Q0U4R2 Cluster: Putative uncharacterized protein; n=1; ...   110   4e-23
UniRef50_O74774 Cluster: Elongation factor 1 alpha related prote...   110   5e-23
UniRef50_Q6JIY6 Cluster: Translation elongation factor 1 alpha; ...   109   7e-23
UniRef50_O13354 Cluster: Eukaryotic peptide chain release factor...   109   7e-23
UniRef50_A2FN77 Cluster: Elongation factor Tu C-terminal domain ...   109   9e-23
UniRef50_Q759Q2 Cluster: ADR221Cp; n=3; Saccharomycetales|Rep: A...   109   9e-23
UniRef50_Q5KFJ4 Cluster: Translation release factor, putative; n...   109   1e-22
UniRef50_Q9NCN6 Cluster: Eukaryotic release factor 3 GTPase subu...   108   2e-22
UniRef50_Q9NCN5 Cluster: Eukaryotic release factor 3 GTPase subu...   108   2e-22
UniRef50_Q2GS47 Cluster: Putative uncharacterized protein; n=1; ...   108   2e-22
UniRef50_Q6WZ47 Cluster: Elongation factor-1 alpha; n=3; Coeloma...   106   6e-22
UniRef50_Q9LM39 Cluster: T10O22.4; n=7; Magnoliophyta|Rep: T10O2...   105   1e-21
UniRef50_Q8SS29 Cluster: TRANSLATION ELONGATION FACTOR 1 ALPHA; ...   105   1e-21
UniRef50_Q4E4V1 Cluster: Elongation factor 1-alpha (EF-1-alpha),...   105   2e-21
UniRef50_Q8WT68 Cluster: Elongation factor-1 alpha; n=3; Endopte...   102   1e-20
UniRef50_Q17263 Cluster: Elongation factor 1 alpha; n=4; Fungi/M...   101   2e-20
UniRef50_P32769 Cluster: Elongation factor 1 alpha-like protein;...   100   4e-20
UniRef50_Q7YZN9 Cluster: Eukaryotic release factor 3; n=2; Dicty...   100   6e-20
UniRef50_Q8IFW1 Cluster: Elongation factor-1 alpha; n=1; Exoneur...    96   9e-19
UniRef50_Q19AS6 Cluster: Translation elongation factor 1 alpha; ...    95   2e-18
UniRef50_Q97MT1 Cluster: GTPase, sulfate adenylate transferase s...    95   2e-18
UniRef50_Q8SRN3 Cluster: TRANSLATION ELONGATION FACTOR 1-ALPHA; ...    95   3e-18
UniRef50_Q4FW53 Cluster: Hsp70 subfamily B suppressor 1; n=3; Le...    94   5e-18
UniRef50_A0E926 Cluster: Chromosome undetermined scaffold_84, wh...    94   5e-18
UniRef50_Q0YG57 Cluster: Small GTP-binding protein domain:Sulfat...    93   6e-18
UniRef50_UPI000150A7E9 Cluster: Elongation factor Tu C-terminal ...    93   1e-17
UniRef50_Q6CFF3 Cluster: Similar to tr|Q9WTY5 Mus musculus ERFS;...    92   1e-17
UniRef50_A6GJE6 Cluster: Sulfate adenylyltransferase, large subu...    91   3e-17
UniRef50_A4XJZ8 Cluster: Sulfate adenylyltransferase, large subu...    91   3e-17
UniRef50_Q24TA2 Cluster: Adenylylsulfate kinase/sulfate adenylyl...    91   5e-17
UniRef50_Q39DS0 Cluster: Sulfate adenylyltransferase, large subu...    90   6e-17
UniRef50_A6TTV2 Cluster: Sulfate adenylyltransferase, large subu...    90   8e-17
UniRef50_Q89UE2 Cluster: NodQ bifunctional enzyme; n=12; Rhizobi...    89   1e-16
UniRef50_Q83JX8 Cluster: Sulfate adenylyltransferase subunit 1; ...    89   1e-16
UniRef50_Q74CF6 Cluster: Elongation factor Tu GTP binding domain...    88   2e-16
UniRef50_Q9L9U8 Cluster: Putative ATP sulfurylase large subunit;...    88   2e-16
UniRef50_Q22GX7 Cluster: Elongation factor Tu C-terminal domain ...    88   2e-16
UniRef50_Q8ZBP2 Cluster: Sulfate adenylyltransferase subunit 1; ...    88   3e-16
UniRef50_Q0G239 Cluster: Binfunctional sulfate adenylyltransfera...    87   7e-16
UniRef50_A4LX06 Cluster: Sulfate adenylyltransferase; n=1; Geoba...    87   7e-16
UniRef50_A4RWT6 Cluster: Predicted protein; n=2; Ostreococcus|Re...    86   1e-15
UniRef50_Q9PD78 Cluster: Bifunctional enzyme cysN/cysC [Includes...    86   1e-15
UniRef50_Q8ZMF5 Cluster: Sulfate adenylyltransferase subunit 1; ...    85   2e-15
UniRef50_Q10600 Cluster: Bifunctional enzyme cysN/cysC [Includes...    85   2e-15
UniRef50_Q08RF5 Cluster: CysN/CysC bifunctional enzyme; n=2; Cys...    85   3e-15
UniRef50_Q7UMW2 Cluster: Bifunctional enzyme cysN/cysC [Includes...    85   3e-15
UniRef50_Q7M9D1 Cluster: GTPASE, SULFATE ADENYLATE TRANSFERASE S...    84   4e-15
UniRef50_Q95UT7 Cluster: Elongation factor 1 alpha short form; n...    84   4e-15
UniRef50_UPI000050FE96 Cluster: COG2895: GTPases - Sulfate adeny...    83   9e-15
UniRef50_A0BL72 Cluster: Chromosome undetermined scaffold_113, w...    83   9e-15
UniRef50_P56893 Cluster: Sulfate adenylyltransferase subunit 1; ...    83   9e-15
UniRef50_Q0A978 Cluster: Sulfate adenylyltransferase, large subu...    83   1e-14
UniRef50_Q8AAP9 Cluster: Sulfate adenylyltransferase subunit 1; ...    83   1e-14
UniRef50_UPI0000F308E4 Cluster: UPI0000F308E4 related cluster; n...    82   2e-14
UniRef50_Q2S507 Cluster: Sulfate adenylyltransferase, large subu...    82   2e-14
UniRef50_Q46516 Cluster: ORFC 179; n=1; Desulfurococcus mobilis|...    82   2e-14
UniRef50_Q82L80 Cluster: Putative sulfate adenylyltransferase la...    79   1e-13
UniRef50_Q7R087 Cluster: GLP_56_7099_8961; n=2; Giardia intestin...    79   1e-13
UniRef50_Q4G4A5 Cluster: Elongation factor 1A; n=86; Eukaryota|R...    79   1e-13
UniRef50_A2WJZ4 Cluster: Putative uncharacterized protein; n=1; ...    79   1e-13
UniRef50_A3HVR6 Cluster: Sulfate adenylyltransferase subunit 1; ...    79   2e-13
UniRef50_Q8NLX2 Cluster: GTPases-Sulfate adenylate transferase s...    78   3e-13
UniRef50_Q5FSE8 Cluster: Sulfate adenylyltransferase subunit 1 /...    78   3e-13
UniRef50_Q9UVK1 Cluster: SUP35 homolog; n=1; Pichia pastoris|Rep...    78   3e-13
UniRef50_P02992 Cluster: Elongation factor Tu, mitochondrial pre...    78   3e-13
UniRef50_Q1ITG6 Cluster: Sulfate adenylyltransferase, large subu...    77   4e-13
UniRef50_A6GM01 Cluster: Bifunctional sulfate adenylyltransferas...    77   4e-13
UniRef50_Q9RGE9 Cluster: Sulfate adenylyltransferase subunit Cys...    77   8e-13
UniRef50_Q0SH95 Cluster: CysN/CysC bifunctional enzyme; n=14; Ac...    76   1e-12
UniRef50_A4SYY3 Cluster: Sulfate adenylyltransferase, large subu...    75   2e-12
UniRef50_Q45W23 Cluster: Tuf1; n=1; uncultured Pseudonocardia sp...    75   3e-12
UniRef50_A4VDD2 Cluster: Elongation factor 1-alpha; n=1; Tetrahy...    75   3e-12
UniRef50_A0JZN0 Cluster: Sulfate adenylyltransferase, large subu...    74   6e-12
UniRef50_UPI0000499770 Cluster: elongation factor-1alpha; n=1; E...    73   7e-12
UniRef50_P18905 Cluster: Elongation factor Tu; n=2; Coleochaetal...    73   1e-11
UniRef50_Q5BEE6 Cluster: Elongation factor Tu; n=1; Emericella n...    73   1e-11
UniRef50_Q8IE20 Cluster: Elongation factor tu, putative; n=9; Ac...    72   2e-11
UniRef50_A1W6V4 Cluster: Sulfate adenylyltransferase, large subu...    71   3e-11
UniRef50_Q5CWA0 Cluster: HBS1 eRFS. GTpase; n=2; Cryptosporidium...    71   5e-11
UniRef50_A0EFI6 Cluster: Elongation factor Tu; n=3; Paramecium t...    71   5e-11
UniRef50_Q0EDG4 Cluster: Mitochondrial EF-Tu2; n=1; Trichinella ...    70   7e-11
UniRef50_UPI0000EB403C Cluster: UPI0000EB403C related cluster; n...    69   1e-10
UniRef50_P91150 Cluster: Tu elongation factor (Ef-tu), mitochond...    69   1e-10
UniRef50_Q4U972 Cluster: Translation elongation factor 1-alpha, ...    69   2e-10
UniRef50_Q7K3V6 Cluster: Elongation factor Tu; n=7; Coelomata|Re...    68   3e-10
UniRef50_P49411 Cluster: Elongation factor Tu, mitochondrial pre...    68   3e-10
UniRef50_Q4QDW8 Cluster: Elongation factor TU, putative; n=5; Tr...    68   4e-10
UniRef50_Q19072 Cluster: Elongation factor Tu homologue precurso...    67   6e-10
UniRef50_Q8TYZ3 Cluster: GTPase-translation elongation factor; n...    67   6e-10
UniRef50_UPI00006CBD5B Cluster: Elongation factor Tu, mitochondr...    65   2e-09
UniRef50_Q9UVK0 Cluster: SUP35 homolog; n=1; Saccharomycodes lud...    65   3e-09
UniRef50_O83217 Cluster: Elongation factor Tu; n=7; cellular org...    64   3e-09
UniRef50_Q1FK57 Cluster: Small GTP-binding protein domain:Sulfat...    60   7e-08
UniRef50_Q25820 Cluster: Elongation factor Tu; n=99; cellular or...    59   1e-07
UniRef50_UPI00006A2885 Cluster: UPI00006A2885 related cluster; n...    58   3e-07
UniRef50_A1HSM1 Cluster: Selenocysteine-specific translation elo...    57   7e-07
UniRef50_Q4JIN1 Cluster: Selenocysteine-specific translation elo...    56   1e-06
UniRef50_A6CK31 Cluster: Selenocysteine-specific translation elo...    55   3e-06
UniRef50_Q1AUJ9 Cluster: Selenocysteine-specific translation elo...    54   5e-06
UniRef50_A3SGF9 Cluster: Translation elongation factor, selenocy...    54   6e-06
UniRef50_Q2B7L6 Cluster: Selenocysteine-specific translation elo...    52   1e-05
UniRef50_Q74NG5 Cluster: NEQ270; n=1; Nanoarchaeum equitans|Rep:...    52   1e-05
UniRef50_Q1MPY9 Cluster: Selenocysteine-specific translation elo...    52   2e-05
UniRef50_A7ANX2 Cluster: Elongation factor Tu GTP binding domain...    52   2e-05
UniRef50_A7H0F4 Cluster: Selenocysteine-specific translation elo...    52   3e-05
UniRef50_A5KED2 Cluster: Elongation factor, putative; n=1; Plasm...    52   3e-05
UniRef50_Q46497 Cluster: Selenocysteine-specific elongation fact...    51   3e-05
UniRef50_A6G2B2 Cluster: Translation elongation factor, selenocy...    51   4e-05
UniRef50_A7PSI5 Cluster: Chromosome chr6 scaffold_28, whole geno...    51   4e-05
UniRef50_A7PFT2 Cluster: Chromosome chr11 scaffold_14, whole gen...    51   4e-05
UniRef50_Q57918 Cluster: Selenocysteine-specific elongation fact...    51   4e-05
UniRef50_Q67QI5 Cluster: Selenocysteine-specific elongation fact...    50   6e-05
UniRef50_Q0ATV7 Cluster: Selenocysteine-specific translation elo...    50   6e-05
UniRef50_A0Z3R3 Cluster: Selenocysteine-specific elongation fact...    50   6e-05
UniRef50_A7PCT1 Cluster: Chromosome chr17 scaffold_12, whole gen...    50   6e-05
UniRef50_Q8XIK3 Cluster: Selenocysteine-specific elongation fact...    50   8e-05
UniRef50_Q7VI67 Cluster: Selenocysteine-specific elongation fact...    50   1e-04
UniRef50_A6BIM9 Cluster: Putative uncharacterized protein; n=1; ...    50   1e-04
UniRef50_Q74GZ1 Cluster: Selenocysteine-specific translation elo...    49   1e-04
UniRef50_Q2LU53 Cluster: Selenocysteine-specific protein transla...    49   1e-04
UniRef50_Q3E0L1 Cluster: Translation elongation factor, selenocy...    49   1e-04
UniRef50_A6P2V2 Cluster: Putative uncharacterized protein; n=1; ...    49   1e-04
UniRef50_Q7R7M3 Cluster: Elongation factor Tu family, putative; ...    49   1e-04
UniRef50_A0BK03 Cluster: Chromosome undetermined scaffold_111, w...    49   1e-04
UniRef50_A7QN79 Cluster: Chromosome undetermined scaffold_131, w...    49   2e-04
UniRef50_Q1Z854 Cluster: Hypothetical selenocysteine-specific tr...    48   2e-04
UniRef50_A0YH51 Cluster: Selenocysteine-specific elongation fact...    48   2e-04
UniRef50_A0LHL0 Cluster: Selenocysteine-specific translation elo...    48   2e-04
UniRef50_Q47F25 Cluster: Translation elongation factor, selenocy...    48   3e-04
UniRef50_Q8TVI5 Cluster: Translation elongation factor, GTPase; ...    48   3e-04
UniRef50_Q0BZB1 Cluster: Selenocysteine-specific translation elo...    48   4e-04
UniRef50_A1FN34 Cluster: Selenocysteine-specific translation elo...    48   4e-04
UniRef50_Q8TJT7 Cluster: Translation initiation factor 2 subunit...    47   5e-04
UniRef50_Q30SC0 Cluster: Translation elongation factor, selenocy...    47   7e-04
UniRef50_A0YGX4 Cluster: Translation elongation factor, selenocy...    47   7e-04
UniRef50_A0KL71 Cluster: Selenocysteine-specific translation elo...    47   7e-04
UniRef50_A4YIX9 Cluster: Protein synthesis factor, GTP-binding; ...    47   7e-04
UniRef50_P55972 Cluster: Translation initiation factor IF-2; n=5...    47   7e-04
UniRef50_Q1NKM4 Cluster: Translation elongation factor, selenocy...    46   0.001
UniRef50_Q18YZ1 Cluster: Selenocysteine-specific translation elo...    46   0.001
UniRef50_A7HHY2 Cluster: Selenocysteine-specific translation elo...    46   0.001
UniRef50_O36041 Cluster: Eukaryotic translation initiation facto...    46   0.001
UniRef50_Q1ZC67 Cluster: Selenocysteine synthase; n=1; Psychromo...    46   0.001
UniRef50_A7Q762 Cluster: Chromosome chr5 scaffold_58, whole geno...    46   0.001
UniRef50_Q46455 Cluster: Selenocysteine-specific elongation fact...    46   0.001
UniRef50_Q1IHM2 Cluster: Selenocysteine-specific translation elo...    46   0.002
UniRef50_Q1ETS8 Cluster: Translation elongation factor, selenocy...    45   0.002
UniRef50_P43927 Cluster: Selenocysteine-specific elongation fact...    45   0.002
UniRef50_Q4S9H1 Cluster: Chromosome undetermined SCAF14696, whol...    45   0.003
UniRef50_A4E707 Cluster: Putative uncharacterized protein; n=1; ...    45   0.003
UniRef50_Q931D5 Cluster: SelB selenocysteine-specific elongation...    44   0.004
UniRef50_Q73LA2 Cluster: Selenocysteine-specific translation elo...    44   0.004
UniRef50_O67141 Cluster: Elongation factor SelB; n=1; Aquifex ae...    44   0.004
UniRef50_P14081 Cluster: Selenocysteine-specific elongation fact...    44   0.004
UniRef50_Q0LF89 Cluster: Selenocysteine-specific translation elo...    44   0.005
UniRef50_A6DB59 Cluster: Putative selenocysteine-specific elonga...    44   0.005
UniRef50_Q663U2 Cluster: Selenocysteine-specific elongation fact...    44   0.007
UniRef50_A4A194 Cluster: Small GTP-binding protein domain; n=1; ...    44   0.007
UniRef50_Q0HP29 Cluster: Selenocysteine-specific translation elo...    43   0.009
UniRef50_Q9VAV2 Cluster: CG12413-PA; n=7; Endopterygota|Rep: CG1...    43   0.009
UniRef50_Q5QTY8 Cluster: Translation initiation factor IF-2; n=1...    43   0.009
UniRef50_Q7VHF6 Cluster: Translation initiation factor IF-2; n=1...    43   0.009
UniRef50_A0X1J6 Cluster: Selenocysteine-specific translation elo...    43   0.012
UniRef50_Q4QHR6 Cluster: Translation initiation factor eif-2b ga...    43   0.012
UniRef50_O62108 Cluster: Putative uncharacterized protein selb-1...    43   0.012
UniRef50_UPI00004996CE Cluster: 116 kda u5 small nuclear ribonuc...    42   0.016
UniRef50_Q8ZZV4 Cluster: Translation initiation factor aIF-2 gam...    42   0.016
UniRef50_Q8EWU0 Cluster: Translation initiation factor IF-2; n=2...    42   0.016
UniRef50_Q7WHG2 Cluster: Translation initiation factor IF-2; n=2...    42   0.016
UniRef50_UPI0000DB7182 Cluster: PREDICTED: similar to elongation...    42   0.021
UniRef50_A7QC01 Cluster: Chromosome chr10 scaffold_76, whole gen...    42   0.021
UniRef50_Q30SS6 Cluster: Initiation factor 2; n=1; Thiomicrospir...    42   0.027
UniRef50_A6DBA3 Cluster: Translation initiation factor IF-2; n=1...    42   0.027
UniRef50_A7PNB2 Cluster: Chromosome chr1 scaffold_22, whole geno...    42   0.027
UniRef50_Q8YQJ1 Cluster: Translation initiation factor IF-2; n=7...    42   0.027
UniRef50_A4RX89 Cluster: Predicted protein; n=2; Ostreococcus|Re...    41   0.036
UniRef50_Q20447 Cluster: Putative uncharacterized protein; n=2; ...    41   0.036
UniRef50_A7QHK9 Cluster: Chromosome chr5 scaffold_98, whole geno...    41   0.048
UniRef50_Q9W2H0 Cluster: CG9841-PA; n=1; Drosophila melanogaster...    41   0.048
UniRef50_A3FPW4 Cluster: Elongation factor-like protein; n=3; Cr...    41   0.048
UniRef50_Q89AC9 Cluster: GTP-binding protein TypA/BipA homolog; ...    41   0.048
UniRef50_Q4FVL5 Cluster: Translation initiation factor IF-2; n=1...    41   0.048
UniRef50_Q72ER1 Cluster: Translation initiation factor IF-2; n=3...    41   0.048
UniRef50_Q5PAJ5 Cluster: Translation initiation factor IF-2; n=3...    40   0.063
UniRef50_Q1ZR84 Cluster: Selenocysteinyl-tRNA-specific translati...    40   0.083
UniRef50_A6Q226 Cluster: Translation initiation factor IF-2; n=5...    40   0.083
UniRef50_A6DKQ3 Cluster: Translation initiation factor IF-2; n=1...    40   0.083
UniRef50_A1SQK9 Cluster: Small GTP-binding protein; n=2; Actinom...    40   0.083
UniRef50_Q4Q2R0 Cluster: Selenocysteine-specific elongation fact...    40   0.083
UniRef50_Q48791 Cluster: Tetracycline resistance protein tetS (T...    40   0.083
UniRef50_Q609C0 Cluster: Translation initiation factor IF-2; n=8...    40   0.083
UniRef50_Q30WJ0 Cluster: Translation initiation factor IF-2; n=1...    40   0.083
UniRef50_Q9RXC2 Cluster: Elongation factor G; n=2; Deinococcus|R...    40   0.11 
UniRef50_A6QBQ5 Cluster: Translation initiation factor IF-2; n=1...    40   0.11 
UniRef50_Q08491 Cluster: Superkiller protein 7; n=2; Saccharomyc...    40   0.11 
UniRef50_UPI00006CBFC8 Cluster: Elongation factor Tu GTP binding...    39   0.15 
UniRef50_Q6LH28 Cluster: Hypothetical selenocysteine-specific tr...    39   0.15 
UniRef50_Q1Q1G5 Cluster: Strongly similar to translation initiat...    39   0.15 
UniRef50_Q1JYY0 Cluster: Selenocysteine-specific translation elo...    39   0.15 
UniRef50_Q0EZ74 Cluster: Translation initiation factor IF-2; n=1...    39   0.15 
UniRef50_A6MVX8 Cluster: Translation initiation factor 2; n=1; R...    39   0.15 
UniRef50_Q7Q5R3 Cluster: ENSANGP00000020583; n=3; Diptera|Rep: E...    39   0.15 
UniRef50_O07170 Cluster: Elongation factor G-like protein; n=24;...    39   0.15 
UniRef50_Q8F2N6 Cluster: Peptide chain release factor 3; n=8; Ba...    39   0.19 
UniRef50_Q5GBH8 Cluster: TetT; n=2; Lactobacillales|Rep: TetT - ...    39   0.19 
UniRef50_A7I3V0 Cluster: Translation initiation factor IF-2; n=1...    39   0.19 
UniRef50_A6BAW2 Cluster: BipA protein; n=1; Vibrio parahaemolyti...    39   0.19 
UniRef50_A5ZAJ3 Cluster: Putative uncharacterized protein; n=1; ...    39   0.19 
UniRef50_A4X2G5 Cluster: Selenocysteine-specific translation elo...    39   0.19 
UniRef50_A3Q882 Cluster: Selenocysteine-specific translation elo...    39   0.19 
UniRef50_Q8I592 Cluster: Elongation factor g, putative; n=1; Pla...    39   0.19 
UniRef50_Q4Y6S3 Cluster: Elongation factor g, putative; n=4; Pla...    39   0.19 
UniRef50_Q4QHR7 Cluster: Eukaryotic translation initiation facto...    39   0.19 
UniRef50_Q9PGR3 Cluster: Translation initiation factor IF-2; n=2...    39   0.19 
UniRef50_P72689 Cluster: Translation initiation factor IF-2; n=8...    39   0.19 
UniRef50_Q3ZXU3 Cluster: Translation initiation factor IF-2; n=8...    39   0.19 
UniRef50_UPI0000E87FA9 Cluster: translation initiation factor IF...    38   0.25 
UniRef50_UPI000050FBE9 Cluster: COG3276: Selenocysteine-specific...    38   0.25 
UniRef50_Q6MAV2 Cluster: Probable peptide chain release factor 3...    38   0.25 
UniRef50_A6CF43 Cluster: Translation initiation factor IF-2; n=1...    38   0.25 
UniRef50_A6S9S7 Cluster: Putative uncharacterized protein; n=1; ...    38   0.25 
UniRef50_Q9WZN3 Cluster: Translation initiation factor IF-2; n=5...    38   0.25 
UniRef50_A7CTC1 Cluster: Peptide chain release factor 3; n=2; Ba...    38   0.34 
UniRef50_A4S2B0 Cluster: Mitochondrial translation initiation fa...    38   0.34 
UniRef50_Q5KNR0 Cluster: GTPase, putative; n=1; Filobasidiella n...    38   0.34 
UniRef50_P0A3B4 Cluster: GTP-binding protein typA/bipA; n=97; Ba...    38   0.34 
UniRef50_Q8D2X6 Cluster: Translation initiation factor IF-2; n=1...    38   0.34 
UniRef50_P47388 Cluster: Translation initiation factor IF-2; n=6...    38   0.34 
UniRef50_Q9RTG5 Cluster: Translation initiation factor IF-2; n=4...    38   0.34 
UniRef50_Q6MMS6 Cluster: Translation initiation factor IF-2; n=1...    38   0.34 
UniRef50_Q7MWJ5 Cluster: GTP-binding protein TypA; n=31; Bacteri...    38   0.44 
UniRef50_Q62AN3 Cluster: Selenocysteine-specific translation elo...    38   0.44 
UniRef50_Q7QZ18 Cluster: GLP_464_49314_47878; n=2; Giardia intes...    38   0.44 
UniRef50_P57772 Cluster: Selenocysteine-specific elongation fact...    38   0.44 
UniRef50_Q92IQ1 Cluster: GTP-binding protein lepA; n=187; Bacter...    38   0.44 
UniRef50_Q7URR0 Cluster: Translation initiation factor IF-2; n=1...    38   0.44 
UniRef50_Q7VA20 Cluster: Translation initiation factor IF-2; n=2...    38   0.44 
UniRef50_Q74CT3 Cluster: Translation initiation factor IF-2; n=2...    38   0.44 
UniRef50_Q8R5Z1 Cluster: Translation initiation factor IF-2; n=3...    38   0.44 
UniRef50_Q6AJY4 Cluster: Translation initiation factor IF-2; n=3...    38   0.44 
UniRef50_A5NXM0 Cluster: Selenocysteine-specific translation elo...    37   0.59 
UniRef50_A5KIG4 Cluster: Putative uncharacterized protein; n=1; ...    37   0.59 
UniRef50_A1AV99 Cluster: Translation initiation factor IF-2; n=3...    37   0.59 
UniRef50_A7PLZ9 Cluster: Chromosome chr14 scaffold_21, whole gen...    37   0.59 
UniRef50_Q6FMS9 Cluster: Candida glabrata strain CBS138 chromoso...    37   0.59 
UniRef50_P44910 Cluster: GTP-binding protein typA/bipA homolog; ...    37   0.59 
UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=5...    37   0.59 
UniRef50_P55875 Cluster: Translation initiation factor IF-2; n=7...    37   0.59 
UniRef50_Q09130 Cluster: Eukaryotic translation initiation facto...    37   0.59 
UniRef50_Q1XDN0 Cluster: Translation initiation factor IF-2, chl...    37   0.59 
UniRef50_A5Z9F8 Cluster: Putative uncharacterized protein; n=1; ...    37   0.78 
UniRef50_A3LLY2 Cluster: GTP-binding protein LepA; n=4; Bacteria...    37   0.78 
UniRef50_Q67MT5 Cluster: Peptide chain release factor 3; n=13; B...    37   0.78 
UniRef50_Q6MTQ0 Cluster: Translation initiation factor IF-2; n=2...    37   0.78 
UniRef50_Q5FQM3 Cluster: Translation initiation factor IF-2; n=8...    37   0.78 
UniRef50_P46943 Cluster: GTP-binding protein GUF1; n=37; root|Re...    37   0.78 
UniRef50_Q2GDP0 Cluster: Translation initiation factor IF-2; n=1...    36   1.0  
UniRef50_Q4HK10 Cluster: Selenocysteine-specific translation elo...    36   1.0  
UniRef50_A6NTY0 Cluster: Putative uncharacterized protein; n=1; ...    36   1.0  
UniRef50_A5UZQ2 Cluster: Translation initiation factor IF-2; n=5...    36   1.0  
UniRef50_Q98RT0 Cluster: Eukaryotic translation initiation facto...    36   1.0  
UniRef50_Q98RS6 Cluster: U5 small nuclear ribonucleoprotein 116 ...    36   1.0  
UniRef50_Q8I243 Cluster: Selenocysteine-specific elongation fact...    36   1.0  
UniRef50_Q8F7K1 Cluster: Translation initiation factor IF-2; n=4...    36   1.0  
UniRef50_O58822 Cluster: Probable translation initiation factor ...    36   1.0  
UniRef50_P41091 Cluster: Eukaryotic translation initiation facto...    36   1.0  
UniRef50_Q2RJM5 Cluster: Translation initiation factor IF-2; n=3...    36   1.4  
UniRef50_A6CUD1 Cluster: Translation initiation factor IF-2; n=1...    36   1.4  
UniRef50_A4E6U7 Cluster: Putative uncharacterized protein; n=1; ...    36   1.4  
UniRef50_A1I9J9 Cluster: Translation elongation factor G; n=1; C...    36   1.4  
UniRef50_A0UWB2 Cluster: Small GTP-binding protein; n=14; Bacter...    36   1.4  
UniRef50_A0NL43 Cluster: Translation initiation factor 2; n=2; O...    36   1.4  
UniRef50_Q2XN58 Cluster: Auxin down-regulated protein; n=2; Glyc...    36   1.4  
UniRef50_Q4N0F2 Cluster: Translation initiation factor IF-2, put...    36   1.4  
UniRef50_O77136 Cluster: Translation initiation factor 2; n=1; A...    36   1.4  
UniRef50_A0BTU2 Cluster: Chromosome undetermined scaffold_128, w...    36   1.4  
UniRef50_A0BPT3 Cluster: Chromosome undetermined scaffold_12, wh...    36   1.4  
UniRef50_Q6CDQ9 Cluster: Similar to DEHA0C03773g Debaryomyces ha...    36   1.4  
UniRef50_Q5KLM1 Cluster: GTP-binding protein 1 (G-protein 1), pu...    36   1.4  
UniRef50_O67825 Cluster: Translation initiation factor IF-2; n=1...    36   1.4  
UniRef50_UPI00015BD5D6 Cluster: UPI00015BD5D6 related cluster; n...    36   1.8  
UniRef50_Q64MT7 Cluster: GTP-binding elongation factor family pr...    36   1.8  
UniRef50_Q0S473 Cluster: Elongation factor EF2; n=1; Rhodococcus...    36   1.8  
UniRef50_A6GK83 Cluster: Translation initiation factor IF-2; n=1...    36   1.8  
UniRef50_A5D2S0 Cluster: Translation initiation factor 2; n=5; C...    36   1.8  
UniRef50_A7R247 Cluster: Chromosome undetermined scaffold_399, w...    36   1.8  
UniRef50_A2EAD8 Cluster: Elongation factor Tu GTP binding domain...    36   1.8  
UniRef50_Q9JHW4 Cluster: Selenocysteine-specific elongation fact...    36   1.8  
UniRef50_P46199 Cluster: Translation initiation factor IF-2, mit...    36   1.8  
UniRef50_UPI00015B5A9A Cluster: PREDICTED: similar to mitochondr...    35   2.4  
UniRef50_A1ZR77 Cluster: Translation elongation factor G; n=2; B...    35   2.4  
UniRef50_A7QSS1 Cluster: Chromosome chr4 scaffold_162, whole gen...    35   2.4  
UniRef50_Q86H50 Cluster: Similar to mitochondrial initiation fac...    35   2.4  
UniRef50_Q4YUV8 Cluster: Selenocysteine-specific elongation fact...    35   2.4  
UniRef50_A7AQT2 Cluster: Elongation factor G 2, mitochondrial, p...    35   2.4  
UniRef50_Q2U373 Cluster: Predicted protein; n=1; Aspergillus ory...    35   2.4  
UniRef50_Q46306 Cluster: Tetracycline resistance protein tetP (T...    35   2.4  
UniRef50_Q67P86 Cluster: Translation initiation factor IF-2; n=1...    35   2.4  
UniRef50_Q98R05 Cluster: Translation initiation factor IF-2; n=8...    35   2.4  
UniRef50_Q5HB61 Cluster: Translation initiation factor IF-2; n=6...    35   2.4  
UniRef50_Q9PKU0 Cluster: Translation initiation factor IF-2; n=1...    35   2.4  
UniRef50_Q8FXT2 Cluster: Translation initiation factor IF-2; n=3...    35   2.4  
UniRef50_P17889 Cluster: Translation initiation factor IF-2; n=6...    35   2.4  
UniRef50_Q8TXJ4 Cluster: Elongation factor 2 (EF-2) [Contains: M...    35   2.4  
UniRef50_Q1IY97 Cluster: Peptide chain release factor 3; n=1; De...    35   3.1  
UniRef50_Q6BVE5 Cluster: Debaryomyces hansenii chromosome C of s...    35   3.1  
UniRef50_A1JVG8 Cluster: Elongation factor 1-alpha; n=2; Gibbere...    35   3.1  
UniRef50_P34617 Cluster: Uncharacterized GTP-binding protein ZK1...    35   3.1  
UniRef50_Q5GS99 Cluster: Translation initiation factor IF-2; n=6...    35   3.1  
UniRef50_Q74IS8 Cluster: Translation initiation factor IF-2; n=3...    35   3.1  
UniRef50_Q8A2A1 Cluster: Translation initiation factor IF-2; n=1...    35   3.1  
UniRef50_Q6B8S2 Cluster: Translation initiation factor IF-2, chl...    35   3.1  
UniRef50_Q9XEK9 Cluster: Translation initiation factor IF-2, chl...    35   3.1  
UniRef50_UPI0000EBC365 Cluster: PREDICTED: hypothetical protein;...    34   4.1  
UniRef50_Q9AA65 Cluster: Elongation factor Tu family protein; n=...    34   4.1  
UniRef50_Q7UN30 Cluster: Elongation factor G; n=2; Planctomyceta...    34   4.1  
UniRef50_Q5WBK2 Cluster: Translation elongation factor G; n=1; B...    34   4.1  
UniRef50_Q1VQ31 Cluster: Tetracycline resistance protein; n=1; P...    34   4.1  
UniRef50_Q1NNQ3 Cluster: Small GTP-binding protein domain; n=4; ...    34   4.1  
UniRef50_Q0HFP5 Cluster: Transcriptional regulator, LysR family;...    34   4.1  
UniRef50_A7IC08 Cluster: Translation initiation factor IF-2; n=2...    34   4.1  
UniRef50_A6PMK2 Cluster: Translation initiation factor IF-2; n=1...    34   4.1  
UniRef50_A0LHL8 Cluster: Translation initiation factor IF-2; n=1...    34   4.1  
UniRef50_Q95Y73 Cluster: Putative uncharacterized protein; n=2; ...    34   4.1  
UniRef50_A7SA88 Cluster: Predicted protein; n=1; Nematostella ve...    34   4.1  
UniRef50_A3LY41 Cluster: Predicted protein; n=3; Saccharomycetac...    34   4.1  
UniRef50_A2R3P3 Cluster: Contig An14c0170, complete genome; n=7;...    34   4.1  
UniRef50_A1DDI0 Cluster: Ribosome biogenesis protein Ria1, putat...    34   4.1  
UniRef50_Q55002 Cluster: Oxytetracycline resistance protein; n=2...    34   4.1  
UniRef50_Q6MD64 Cluster: Translation initiation factor IF-2; n=1...    34   4.1  
UniRef50_Q9AC25 Cluster: Translation initiation factor IF-2; n=1...    34   4.1  
UniRef50_O29490 Cluster: Probable translation initiation factor ...    34   4.1  
UniRef50_Q97KR3 Cluster: Tetracycline resistance protein tetP, c...    34   5.5  
UniRef50_Q2LWU6 Cluster: Bacterial protein translation Initiatio...    34   5.5  
UniRef50_Q1ZVV6 Cluster: GTP-binding regulator BipA/TypA; n=4; V...    34   5.5  
UniRef50_A0Q2C8 Cluster: Translation elongation factor G; n=1; C...    34   5.5  
UniRef50_Q00ZZ1 Cluster: GTP-binding membrane protein LepA homol...    34   5.5  
UniRef50_A4RU91 Cluster: Chloroplast translation initiation fact...    34   5.5  
UniRef50_Q7YXS0 Cluster: MB2; n=5; Plasmodium gallinaceum|Rep: M...    34   5.5  
UniRef50_Q4QAJ7 Cluster: Translation initiation factor IF-2, put...    34   5.5  
UniRef50_Q24BY4 Cluster: Elongation factor Tu GTP binding domain...    34   5.5  
UniRef50_Q0GFE8 Cluster: Eukaryotic translation initiation facto...    34   5.5  
UniRef50_Q4P257 Cluster: Putative uncharacterized protein; n=1; ...    34   5.5  
UniRef50_Q1E0C9 Cluster: Putative uncharacterized protein; n=1; ...    34   5.5  
UniRef50_Q4JA97 Cluster: GTP-binding protein 1; n=4; Sulfolobace...    34   5.5  
UniRef50_A0RUB8 Cluster: Translation initiation factor 2; n=2; T...    34   5.5  
UniRef50_Q6AJD2 Cluster: Peptide chain release factor 3; n=41; B...    34   5.5  
UniRef50_Q5NQ27 Cluster: Translation initiation factor IF-2; n=2...    34   5.5  
UniRef50_Q73NP6 Cluster: Translation initiation factor IF-2; n=2...    34   5.5  
UniRef50_Q68WI4 Cluster: Translation initiation factor IF-2; n=1...    34   5.5  
UniRef50_Q4FNM9 Cluster: Translation initiation factor IF-2; n=2...    34   5.5  
UniRef50_Q660H9 Cluster: Elongation factor G 2; n=3; Borrelia bu...    34   5.5  
UniRef50_UPI0000D62D3D Cluster: UPI0000D62D3D related cluster; n...    33   7.2  
UniRef50_Q2YZV2 Cluster: Translation elongation factor G; n=1; u...    33   7.2  
UniRef50_A6G6E0 Cluster: Protein translation elongation factor G...    33   7.2  
UniRef50_A6G5J6 Cluster: Translation initiation factor IF-2; n=1...    33   7.2  
UniRef50_A6ET18 Cluster: GTP-binding elongation factor family pr...    33   7.2  
UniRef50_A4FHF5 Cluster: Tetracycline resistance protein; n=1; S...    33   7.2  
UniRef50_A3ZU78 Cluster: Translation initiation factor; n=1; Bla...    33   7.2  
UniRef50_A2VTQ7 Cluster: Elongation factor EF-Tu; n=1; Burkholde...    33   7.2  
UniRef50_A7P1C4 Cluster: Chromosome chr19 scaffold_4, whole geno...    33   7.2  
UniRef50_Q9N398 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_Q583L1 Cluster: Selenocysteine-tRNA-specific elongation...    33   7.2  
UniRef50_Q4UIN6 Cluster: GTP-binding protein, LepA subfamily, pu...    33   7.2  
UniRef50_Q4QBM3 Cluster: Translation initiation factor IF-2, put...    33   7.2  
UniRef50_Q38BU9 Cluster: GTP-binding protein, putative; n=3; Try...    33   7.2  
UniRef50_Q22A26 Cluster: Elongation factor Tu GTP binding domain...    33   7.2  
UniRef50_Q6CBI0 Cluster: Yarrowia lipolytica chromosome C of str...    33   7.2  
UniRef50_Q2GQL9 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_A6R794 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_A5DTX8 Cluster: Putative uncharacterized protein; n=3; ...    33   7.2  
UniRef50_Q97S57 Cluster: Translation initiation factor IF-2; n=9...    33   7.2  
UniRef50_Q7VQM3 Cluster: Translation initiation factor IF-2; n=2...    33   7.2  
UniRef50_O59683 Cluster: Translation initiation factor IF-2, mit...    33   7.2  
UniRef50_UPI00015B4CFA Cluster: PREDICTED: similar to IP15264p; ...    33   9.6  
UniRef50_UPI0000D9AD7A Cluster: PREDICTED: similar to eukaryotic...    33   9.6  
UniRef50_UPI000023E7D4 Cluster: hypothetical protein FG06348.1; ...    33   9.6  
UniRef50_Q8YY79 Cluster: ABC transporter ATP-binding protein; n=...    33   9.6  
UniRef50_Q8UFQ0 Cluster: Tetracycline resistance protein, tetM/t...    33   9.6  
UniRef50_Q7MVV0 Cluster: Translation elongation factor G, putati...    33   9.6  
UniRef50_Q6AKM0 Cluster: Putative uncharacterized protein; n=1; ...    33   9.6  
UniRef50_Q10878 Cluster: POSSIBLE FATTY-ACID-CoA LIGASE FADD10; ...    33   9.6  
UniRef50_Q4C3K5 Cluster: Putative uncharacterized protein; n=1; ...    33   9.6  
UniRef50_Q4AGI8 Cluster: Elongation factor G, C-terminal:Protein...    33   9.6  
UniRef50_Q11PK5 Cluster: Translation initiation factor IF-2; n=1...    33   9.6  
UniRef50_Q0AYI8 Cluster: Translation initiation factor IF-2; n=1...    33   9.6  
UniRef50_A6PUV8 Cluster: Small GTP-binding protein; n=1; Victiva...    33   9.6  
UniRef50_A6EB22 Cluster: Translation initiation factor IF-2; n=2...    33   9.6  
UniRef50_A5CEN6 Cluster: Translation initiation factor IF-2; n=1...    33   9.6  
UniRef50_A0JYS6 Cluster: GTP-binding protein TypA; n=101; Bacter...    33   9.6  
UniRef50_Q7Q3I6 Cluster: ENSANGP00000010178; n=1; Anopheles gamb...    33   9.6  
UniRef50_Q4UIT0 Cluster: Elongation factor 2, putative; n=2; The...    33   9.6  
UniRef50_A7S2I1 Cluster: Predicted protein; n=1; Nematostella ve...    33   9.6  
UniRef50_Q5KGT3 Cluster: Pre-mRNA splicing factor, putative; n=3...    33   9.6  
UniRef50_Q4P305 Cluster: Putative uncharacterized protein; n=1; ...    33   9.6  
UniRef50_Q6YR66 Cluster: Translation initiation factor IF-2; n=3...    33   9.6  
UniRef50_Q3SWP9 Cluster: Translation initiation factor IF-2; n=8...    33   9.6  
UniRef50_O78489 Cluster: Translation initiation factor IF-2, chl...    33   9.6  
UniRef50_P39677 Cluster: Elongation factor G 2, mitochondrial pr...    33   9.6  

>UniRef50_Q05639 Cluster: Elongation factor 1-alpha 2; n=8397;
           root|Rep: Elongation factor 1-alpha 2 - Homo sapiens
           (Human)
          Length = 463

 Score =  280 bits (686), Expect = 4e-74
 Identities = 133/195 (68%), Positives = 148/195 (75%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 73  IDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNPA V FVP
Sbjct: 133 TREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISGWHGDNMLEPS  MPWFKGW+VERKEG A G  L+EALD ILPP RP   P   P + 
Sbjct: 193 ISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQD 252

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 253 VYKIGGIGTVPVGRV 267



 Score =  145 bits (352), Expect = 1e-33
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>UniRef50_UPI00005A4635 Cluster: PREDICTED: similar to statin-like;
           n=2; Canis lupus familiaris|Rep: PREDICTED: similar to
           statin-like - Canis familiaris
          Length = 667

 Score =  215 bits (526), Expect = 9e-55
 Identities = 102/133 (76%), Positives = 112/133 (84%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+LWKFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQ
Sbjct: 353 IDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQ 412

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA+TLGVKQLIVGVNKMDS           +  ++     +++GYNPA V FVP
Sbjct: 413 TREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVP 472

Query: 616 ISGWHGDNMLEPS 654
           ISGWHGDNMLEPS
Sbjct: 473 ISGWHGDNMLEPS 485



 Score =  145 bits (352), Expect = 1e-33
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 281 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 340

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 341 DKLKAERE 348


>UniRef50_Q5EMT9 Cluster: Elongation factor 1-alpha-like protein;
           n=6; Fungi/Metazoa group|Rep: Elongation factor
           1-alpha-like protein - Magnaporthe grisea (Rice blast
           fungus) (Pyricularia grisea)
          Length = 473

 Score =  215 bits (524), Expect = 2e-54
 Identities = 111/208 (53%), Positives = 142/208 (68%), Gaps = 13/208 (6%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KY VT+IDAPGHRDFIKNMITGTSQADCA+L++ AGTGEFEAGISK+GQ
Sbjct: 74  IDIALWKFETAKYQVTVIDAPGHRDFIKNMITGTSQADCAILVIGAGTGEFEAGISKDGQ 133

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGV+QLIV VNKMD+        D  +  ++  +  +++G+NP +V FVP
Sbjct: 134 TREHALLAFTLGVRQLIVAVNKMDTAKWAQSRYD--EIVKETSNFLKKIGFNPDSVPFVP 191

Query: 616 ISGWHGDNMLEPSTKM--------PWFKGW-QVERKEGKAD----GKCLIEALDAILPPA 756
           ISG++GD+M+  S  +        PW+KGW +   K+GK +    G  L +A+D + PP 
Sbjct: 192 ISGFNGDHMISESADIKGNISPNAPWYKGWTKTVNKDGKKEKVIGGASLQDAIDDVTPPT 251

Query: 757 RPLTSPCVFPARRIXNSVVXVPCPSGRI 840
           RP   P   P + +         P GRI
Sbjct: 252 RPTDKPLRLPLQDVYKIGGIGTVPVGRI 279



 Score =  127 bits (306), Expect = 4e-28
 Identities = 57/66 (86%), Positives = 63/66 (95%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 227
           KEK+H+N+VVIGHVDSGKSTTTGHLIYK  GID+RTIEK+EKEA E+GKGSFKYAWVLDK
Sbjct: 4   KEKSHLNVVVIGHVDSGKSTTTGHLIYKLKGIDQRTIEKYEKEAAELGKGSFKYAWVLDK 63

Query: 228 LKAERE 245
           LKAERE
Sbjct: 64  LKAERE 69


>UniRef50_Q2U0M0 Cluster: Translation elongation factor EF-1
           alpha/Tu; n=1; Aspergillus oryzae|Rep: Translation
           elongation factor EF-1 alpha/Tu - Aspergillus oryzae
          Length = 534

 Score =  202 bits (493), Expect = 9e-51
 Identities = 98/183 (53%), Positives = 131/183 (71%), Gaps = 2/183 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI+L  FET K+ VT+IDAPGHRD+IKN ITG SQADCA+L+ +A  GEFEAG+ + GQ
Sbjct: 183 IDISLCTFETPKFVVTVIDAPGHRDYIKNTITGASQADCAILVTSATNGEFEAGVDQGGQ 242

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           +R+H +LA+TLGV+QLIV VNKMD+  +      L +  ++     +++GYNP AVAFVP
Sbjct: 243 SRQHLVLAYTLGVRQLIVAVNKMDTPRY--TDDCLNEIVKETSDFIKKIGYNPKAVAFVP 300

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPA-RPLTS-PCVFPA 789
           ISG +GDN++E S  MPWFKGW  E K G   GK L++A+DA++ P+ R  T+ P   P 
Sbjct: 301 ISGLYGDNLVEESQNMPWFKGWTSETKYGVLKGKTLLDAIDALVTPSHRNATNKPLGLPI 360

Query: 790 RRI 798
           R +
Sbjct: 361 RDV 363



 Score = 53.2 bits (122), Expect = 8e-06
 Identities = 34/99 (34%), Positives = 48/99 (48%), Gaps = 19/99 (19%)
 Frame = +3

Query: 6   YYTQFVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKF------ 167
           Y+T  V +      +EK HI  V +GH+D GKSTT   LIY+ G +    I ++      
Sbjct: 81  YFTSSVAKPFLACNREKPHITAVFLGHLDHGKSTTADQLIYQYGRVSGNPIAEYGSMLSL 140

Query: 168 -------------EKEAQEMGKGSFKYAWVLDKLKAERE 245
                            QE G  S+KY WV++KL+AER+
Sbjct: 141 SSDLLCAGARPHDNHSPQEAGP-SYKYGWVIEKLRAERK 178


>UniRef50_P13905 Cluster: Elongation factor 1-alpha; n=2224;
           cellular organisms|Rep: Elongation factor 1-alpha -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 449

 Score =  202 bits (492), Expect = 1e-50
 Identities = 105/195 (53%), Positives = 127/195 (65%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQ
Sbjct: 73  IDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLAFTLGVKQ+I   NKMD+           +  ++     +++GYNP  + FVP
Sbjct: 133 TREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           ISG+ GDNM+E ST + W+K            G  L+EALD I  P RP   P   P + 
Sbjct: 193 ISGFEGDNMIERSTNLDWYK------------GPTLLEALDQINEPKRPSDKPLRLPLQD 240

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 241 VYKIGGIGTVPVGRV 255



 Score =  130 bits (313), Expect = 6e-29
 Identities = 61/68 (89%), Positives = 62/68 (91%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>UniRef50_UPI0000E47BF2 Cluster: PREDICTED: similar to elongation
           factor 1 alpha; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to elongation factor 1 alpha -
           Strongylocentrotus purpuratus
          Length = 570

 Score =  178 bits (433), Expect = 2e-43
 Identities = 88/161 (54%), Positives = 110/161 (68%), Gaps = 1/161 (0%)
 Frame = +1

Query: 361 QADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDL 540
           +ADCAVL+VAAG GEFEAGISK+GQTREHALL +TLGVKQLIV VNKMDS  ++      
Sbjct: 333 KADCAVLVVAAGIGEFEAGISKDGQTREHALLCYTLGVKQLIVAVNKMDSAQYNEAR--F 390

Query: 541 RKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLE-PSTKMPWFKGWQVERKEGKADGK 717
           ++  R+     +++GYNP AV F+PISGW GDNM+E  +T MPWFKGW +ERK+  A G 
Sbjct: 391 KEIVREVSGYIKKVGYNPKAVPFIPISGWVGDNMMEAATTTMPWFKGWSIERKDNNASGV 450

Query: 718 CLIEALDAILPPARPLTSPCVFPARRIXNSVVXVPCPSGRI 840
            L+ ALDAI+ P RP   P   P + +         P GR+
Sbjct: 451 TLLNALDAIMLPKRPHDKPLRLPLQDVYKIGGIGTVPVGRV 491


>UniRef50_P35021 Cluster: Elongation factor 1-alpha; n=53; cellular
           organisms|Rep: Elongation factor 1-alpha - Sulfolobus
           solfataricus
          Length = 435

 Score =  147 bits (355), Expect = 5e-34
 Identities = 81/195 (41%), Positives = 109/195 (55%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I++   +FET KY+ TIIDAPGHRDF+KNMITG SQAD A+L+V+A  GE+EAG+S  GQ
Sbjct: 72  INLTFMRFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILVVSAKKGEYEAGMSVEGQ 131

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREH +LA T+G+ QLIV VNKMD           ++   +     R  G+N   V FVP
Sbjct: 132 TREHIILAKTMGLDQLIVAVNKMDLTEPPYDEKRYKEIVDQVSKFMRSYGFNTNKVRFVP 191

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           +    GDN+   S  M W+ G  +E            E LD +  P +P+  P   P + 
Sbjct: 192 VVAPAGDNITHRSENMKWYNGPTLE------------EYLDQLELPPKPVDKPLRIPIQD 239

Query: 796 IXNSVVXVPCPSGRI 840
           + +       P GR+
Sbjct: 240 VYSISGVGTVPVGRV 254



 Score = 76.2 bits (179), Expect = 1e-12
 Identities = 32/65 (49%), Positives = 51/65 (78%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           +K H+N++VIGH+D GKST  G L+   G ID++T+++ E+ A+++GK S K+A++LD+L
Sbjct: 3   QKPHLNLIVIGHIDHGKSTLVGRLLMDRGFIDEKTVKEAEEAAKKLGKESEKFAFLLDRL 62

Query: 231 KAERE 245
           K ERE
Sbjct: 63  KEERE 67


>UniRef50_O93729 Cluster: Elongation factor 1-alpha; n=20;
           Archaea|Rep: Elongation factor 1-alpha - Pyrobaculum
           aerophilum
          Length = 444

 Score =  144 bits (350), Expect = 2e-33
 Identities = 72/174 (41%), Positives = 102/174 (58%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 456
           FET+K ++TIID PGHRDF+KNMI G SQAD A+ +++A  GEFEA I   GQ REH  L
Sbjct: 90  FETNKLFITIIDLPGHRDFVKNMIVGASQADAALFVISARPGEFEAAIGPQGQGREHLFL 149

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGD 636
             TLGV+Q++V VNKMD +N+        + + +     + LGY+P+ + F+P+S   GD
Sbjct: 150 IRTLGVQQIVVAVNKMDVVNYD--QKRYEQVKAEVSKLLKLLGYDPSKIHFIPVSAIKGD 207

Query: 637 NMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARRI 798
           N+   S+  PW+             G  L+E  D+  PP RP+  P   P + +
Sbjct: 208 NIKTKSSNTPWY------------TGPTLLEVFDSFQPPQRPVDKPLRMPIQDV 249



 Score = 81.4 bits (192), Expect = 3e-14
 Identities = 31/65 (47%), Positives = 50/65 (76%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           +K HIN+ V+GHVD+GKST  G L+Y+ G +D++ +++ E+ A+++GK  F +AW+LD+ 
Sbjct: 14  QKPHINLAVVGHVDNGKSTLVGRLLYETGYVDEKALKEIEEMAKKIGKEDFAFAWILDRF 73

Query: 231 KAERE 245
           K ERE
Sbjct: 74  KEERE 78


>UniRef50_UPI0000EB0538 Cluster: UPI0000EB0538 related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB0538 UniRef100
           entry - Canis familiaris
          Length = 357

 Score =  144 bits (349), Expect = 3e-33
 Identities = 72/85 (84%), Positives = 77/85 (90%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +DI+LWKFETSKYYVTI DA GH+  IKNMITGT QADCAVLIVAAG GEFEAGISK GQ
Sbjct: 74  VDISLWKFETSKYYVTITDATGHKH-IKNMITGTPQADCAVLIVAAGVGEFEAGISKMGQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDS 510
           TREHALLA TLGVKQL+VGVNK+DS
Sbjct: 133 TREHALLA-TLGVKQLVVGVNKIDS 156



 Score =  117 bits (281), Expect = 5e-25
 Identities = 58/70 (82%), Positives = 60/70 (85%), Gaps = 2/70 (2%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDS--GKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 215
           MGKE THINI+VI H     GKSTTTGHLIYKCGGIDKRTIEKFE EA EMGKGSF+YAW
Sbjct: 1   MGKEMTHINIIVISHWMHRLGKSTTTGHLIYKCGGIDKRTIEKFE-EAAEMGKGSFRYAW 59

Query: 216 VLDKLKAERE 245
           VLDKLKAE E
Sbjct: 60  VLDKLKAEHE 69


>UniRef50_Q9Y450 Cluster: HBS1-like protein; n=43; Euteleostomi|Rep:
           HBS1-like protein - Homo sapiens (Human)
          Length = 684

 Score =  142 bits (343), Expect = 1e-32
 Identities = 74/173 (42%), Positives = 102/173 (58%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+ + KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQ
Sbjct: 326 MDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQ 385

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREH LL  +LGV QL V VNKMD +N        ++   K  H  ++ G+  + V F+P
Sbjct: 386 TREHGLLVRSLGVTQLAVAVNKMDQVNWQ--QERFQEITGKLGHFLKQAGFKESDVGFIP 443

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP 774
            SG  G+N++  S      K ++         G CL+E +D+  PP R +  P
Sbjct: 444 TSGLSGENLITRSQSSELTKWYK---------GLCLLEQIDSFKPPQRSIDKP 487



 Score = 86.2 bits (204), Expect = 1e-15
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 234 AERE 245
            ERE
Sbjct: 318 EERE 321


>UniRef50_A7RM15 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 473

 Score =  141 bits (342), Expect = 2e-32
 Identities = 72/176 (40%), Positives = 107/176 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+ L +F+T    +T++DAPGH+DFI NMITG +QAD A+L+V A TGEFEAG    GQ
Sbjct: 117 MDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQ 176

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHA+L  +LGV QLIV +NK+D ++             K  H  +++G+  + V +VP
Sbjct: 177 TREHAILVRSLGVTQLIVAINKLDMMSWS--EERYLHIVSKLKHFLKQVGFKDSDVVYVP 234

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVF 783
           +SG  G+N+++P T+    K +Q         G+CL++ +D    P R +  P  F
Sbjct: 235 VSGLSGENLVKPCTEEKLKKWYQ---------GQCLVDRIDEFKSPKRDMDKPWRF 281



 Score = 63.7 bits (148), Expect = 6e-09
 Identities = 33/82 (40%), Positives = 48/82 (58%), Gaps = 13/82 (15%)
 Frame = +3

Query: 39  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFE-------------KEA 179
           K  + K  +N+V+IGHVD+GKST  GHL++  G + K+ + K+               E+
Sbjct: 31  KRHQGKELLNLVIIGHVDAGKSTLMGHLLFLLGDVSKKAMHKYPFFFLIIIFNLKACTES 90

Query: 180 QEMGKGSFKYAWVLDKLKAERE 245
           ++ GK SF YAWVLD+   ERE
Sbjct: 91  KKAGKASFAYAWVLDETGEERE 112


>UniRef50_Q96TP0 Cluster: Elongation factor 1 alpha; n=5;
           Fungi/Metazoa group|Rep: Elongation factor 1 alpha -
           Gibberella intermedia (Bulb rot disease fungus)
           (Fusariumproliferatum)
          Length = 108

 Score =  137 bits (331), Expect = 4e-31
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 1/69 (1%)
 Frame = +3

Query: 42  MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 218
           MGKE KTH+N+VVIGHVDSGKSTTTGHLIY+CGGIDKRTIEKFEKEA E+GKGSFKYAWV
Sbjct: 1   MGKEDKTHLNVVVIGHVDSGKSTTTGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWV 60

Query: 219 LDKLKAERE 245
           LDKLKAERE
Sbjct: 61  LDKLKAERE 69



 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 32/35 (91%), Positives = 34/35 (97%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTS 360
           IDIALWKFET +YYVT+IDAPGHRDFIKNMITGTS
Sbjct: 74  IDIALWKFETPRYYVTVIDAPGHRDFIKNMITGTS 108


>UniRef50_Q5UHI3 Cluster: EF-1 alpha-like protein; n=6;
           Eukaryota|Rep: EF-1 alpha-like protein - Bigelowiella
           natans (Pedinomonas minutissima) (Chlorarachnion
           sp.(strain CCMP 621))
          Length = 513

 Score =  135 bits (327), Expect = 1e-30
 Identities = 82/200 (41%), Positives = 109/200 (54%), Gaps = 29/200 (14%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK--------N 429
           +F T+ ++ T+IDAPGH+DFIKNMI+G SQAD A+L+V A  G FEA I K         
Sbjct: 93  EFHTTNFHYTVIDAPGHKDFIKNMISGASQADVALLMVPAKKGGFEAAIQKGEGGDAANK 152

Query: 430 GQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGY------- 588
           GQTR HA L   LG++Q+IVGVNKMD  +        ++ ++      ++ G+       
Sbjct: 153 GQTRHHAELTKLLGIQQIIVGVNKMDEKSVKYDQARYKEIKKNMLSMLKQSGWKINGKLT 212

Query: 589 ----------NPAAVAFVPISGWHGDNMLEPSTKMPWF--KGWQVERKEG-KADGKCLIE 729
                      P  +  +PISGW GDN++ PSTKMPWF  KGW      G K  G+ L +
Sbjct: 213 KELKEAGKKKGPNLIPVIPISGWCGDNLIVPSTKMPWFNKKGWTATTPSGVKTKGETLFQ 272

Query: 730 ALDAILPP-ARPLTSPCVFP 786
           ALD  + P  R L  P   P
Sbjct: 273 ALDQFVEPVTRDLEKPLRCP 292



 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 32/65 (49%), Positives = 48/65 (73%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           +K H+ +V++GHVD+GKSTTTGHL+++ G +D+R       +A+EM K SF +A+ +DK 
Sbjct: 18  DKPHLGVVIVGHVDAGKSTTTGHLLFELGTMDERAKADLIAKAKEMKKESFAFAFFMDKQ 77

Query: 231 KAERE 245
           K ERE
Sbjct: 78  KEERE 82


>UniRef50_Q96TK8 Cluster: Translation elongation factor 1 alpha;
           n=1; Phellopilus nigrolimitatus|Rep: Translation
           elongation factor 1 alpha - Phellopilus nigrolimitatus
          Length = 134

 Score =  135 bits (326), Expect = 2e-30
 Identities = 70/132 (53%), Positives = 85/132 (64%)
 Frame = +1

Query: 367 DCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRK 546
           DCA+LI+A GTGEFEAGISK+GQTREHALLAFTLGV+QLIV VNKMD+ N    +   R 
Sbjct: 1   DCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTTNGGPRAVSARL 60

Query: 547 SRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLI 726
           S +K+P +SRRL      +              +    MPW+KGW  E K G   GK L+
Sbjct: 61  S-KKHPTSSRRLVTTRRLLPSFRFRAGTVTTCWKSLPSMPWYKGWTKETKAGVVKGKTLL 119

Query: 727 EALDAILPPARP 762
           +A+DAI PP RP
Sbjct: 120 DAIDAIEPPLRP 131


>UniRef50_P90922 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 610

 Score =  134 bits (325), Expect = 2e-30
 Identities = 74/173 (42%), Positives = 105/173 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +DI    FETS   + ++DAPGH+DFI NMITGTSQAD A+L+V A TGEFE G    GQ
Sbjct: 254 MDIGRTSFETSHRRIVLLDAPGHKDFISNMITGTSQADAAILVVNATTGEFETGFENGGQ 313

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+EHALL  +LGV QLIV VNK+D+++      D  K+       +R+ G++     FVP
Sbjct: 314 TKEHALLLRSLGVTQLIVAVNKLDTVDWSQDRFDEIKNNLSV-FLTRQAGFSKP--KFVP 370

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP 774
           +SG+ G+N+++   ++ W+            DG CL+E +D+ + P  P   P
Sbjct: 371 VSGFTGENLIK-RMELDWY------------DGPCLLELIDSFVAPQPPSDGP 410



 Score = 83.0 bits (196), Expect = 9e-15
 Identities = 36/65 (55%), Positives = 48/65 (73%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           +K  IN++V+GHVD+GKST  GHL++    +D RTI+KF+ EA   GK SF YAWVLD+ 
Sbjct: 185 DKDLINLIVVGHVDAGKSTLMGHLLHDLEVVDSRTIDKFKHEAARNGKASFAYAWVLDET 244

Query: 231 KAERE 245
           + ERE
Sbjct: 245 EEERE 249


>UniRef50_A5X901 Cluster: Elongation factor 1-alpha; n=2;
           Chilodonella uncinata|Rep: Elongation factor 1-alpha -
           Chilodonella uncinata
          Length = 403

 Score =  134 bits (323), Expect = 4e-30
 Identities = 76/179 (42%), Positives = 105/179 (58%), Gaps = 2/179 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI   +  T      ++DAPGHRDF+K++ITG  QAD  +L+V A  GEFEAGISK+GQ
Sbjct: 58  IDIHKTQIYTENRNYMLVDAPGHRDFVKSLITGVCQADFCLLVVVAAAGEFEAGISKDGQ 117

Query: 436 TREHALLAFTLGVKQLIVGVNKMD--SLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAF 609
           TRE ALLA+TLGVKQ IV V+KMD  S+N+  +     ++  +   T  ++G     + F
Sbjct: 118 TREQALLAYTLGVKQFIVVVSKMDHKSVNYSQIRFAEIQTEIRLMFT--KMGVKADQIPF 175

Query: 610 VPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFP 786
           V IS W GDN+ + S  M W++G              L+EA+D +  P +P+  P   P
Sbjct: 176 VAISAWFGDNIKDRSGNMAWYQG------------PTLLEAMDNLPQPVKPVGEPLRIP 222



 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 19/51 (37%), Positives = 33/51 (64%)
 Frame = +3

Query: 93  SGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           SGKST   HL Y CGG+D+RT   ++++ + MG     + W++D+ + +R+
Sbjct: 1   SGKSTIVAHLAYLCGGLDRRTRMDYDEQRKLMGDKPLSFGWLMDRYRTDRD 51


>UniRef50_Q2ABX8 Cluster: Elongation factor 1-alpha; n=1; Megacopta
           punctatissima|Rep: Elongation factor 1-alpha - Megacopta
           punctatissima
          Length = 187

 Score =  133 bits (322), Expect = 5e-30
 Identities = 55/63 (87%), Positives = 61/63 (96%)
 Frame = +1

Query: 574 RRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPP 753
           +++GYNPA+VAFVPISGWHGDNMLEPS KMPWFKGW +ERKEGKADGKCLIEALDAILPP
Sbjct: 46  KKIGYNPASVAFVPISGWHGDNMLEPSDKMPWFKGWAIERKEGKADGKCLIEALDAILPP 105

Query: 754 ARP 762
           +RP
Sbjct: 106 SRP 108



 Score = 41.9 bits (94), Expect = 0.021
 Identities = 19/27 (70%), Positives = 21/27 (77%)
 Frame = +3

Query: 528 EPRFEEIKKEVSSYIKKIGLQPSCCRF 608
           + RFEEIKKEVSSYIKKIG  P+   F
Sbjct: 31  QSRFEEIKKEVSSYIKKIGYNPASVAF 57


>UniRef50_P15170 Cluster: G1 to S phase transition protein 1
           homolog; n=77; Eukaryota|Rep: G1 to S phase transition
           protein 1 homolog - Homo sapiens (Human)
          Length = 499

 Score =  131 bits (317), Expect = 2e-29
 Identities = 65/142 (45%), Positives = 89/142 (62%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQ
Sbjct: 140 VEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQ 199

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           TREHA+LA T GVK LIV +NKMD    +  +    + + K     +++G+NP   + F+
Sbjct: 200 TREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFM 259

Query: 613 PISGWHGDNMLEPSTKMPWFKG 678
           P SG  G N+ E S   PW+ G
Sbjct: 260 PCSGLTGANLKEQSDFCPWYIG 281



 Score = 77.0 bits (181), Expect = 6e-13
 Identities = 32/70 (45%), Positives = 49/70 (70%)
 Frame = +3

Query: 36  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 215
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 66  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 125

Query: 216 VLDKLKAERE 245
            LD  + ER+
Sbjct: 126 ALDTNQEERD 135


>UniRef50_UPI0000D55B6A Cluster: PREDICTED: similar to CG1898-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1898-PA - Tribolium castaneum
          Length = 792

 Score =  130 bits (315), Expect = 3e-29
 Identities = 75/195 (38%), Positives = 105/195 (53%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+   +FET   +VT++DAPGH+DFI NMI+G  QAD A+L+V A  GEFE G    GQ
Sbjct: 434 MDVGRSQFETKSKHVTLLDAPGHKDFIPNMISGAGQADVALLVVDATRGEFETGFDFGGQ 493

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALL  +LGV QL V +NK+D+++      D     +K     ++ G+    V FVP
Sbjct: 494 TREHALLVRSLGVTQLAVAINKLDTVSWSKERFD--DISQKLKVFLKQAGFREGDVTFVP 551

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
            SG  G N+++  T+      W         +G CL+E +D    P RP++ P       
Sbjct: 552 CSGLTGQNLVDKPTENELLT-WY--------NGPCLLEVIDNFRTPERPVSKPFRLSIND 602

Query: 796 IXNSVVXVPCPSGRI 840
           I        C SGR+
Sbjct: 603 IFKGTGSGFCVSGRV 617



 Score = 84.2 bits (199), Expect = 4e-15
 Identities = 35/66 (53%), Positives = 51/66 (77%)
 Frame = +3

Query: 45  GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 224
           G  K H+ +VVIGHVD+GKST  GHL+Y  G ++++T+ K+E+E++++GK SF YAWVLD
Sbjct: 363 GDSKEHLYMVVIGHVDAGKSTLMGHLLYDLGQVNQKTMHKYEQESRKVGKQSFMYAWVLD 422

Query: 225 KLKAER 242
           +   ER
Sbjct: 423 ETGEER 428


>UniRef50_A6RVA8 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 756

 Score =  130 bits (315), Expect = 3e-29
 Identities = 82/196 (41%), Positives = 107/196 (54%), Gaps = 1/196 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIA+ KFET K   TI+DAPGHRDFI NMI G SQAD AVL++ A  G FE+G+   GQ
Sbjct: 413 IDIAMNKFETEKTTFTILDAPGHRDFIPNMIAGASQADFAVLVIDASVGSFESGL--KGQ 470

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+EHALLA ++GV+++I+ VNK+D++       D  +  ++        G+    + F+P
Sbjct: 471 TKEHALLARSMGVQRIIIAVNKLDTVGWSQERFD--EISQQVSAFLTAAGFQEQNIKFIP 528

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
            SG HGDN+   ST+      W          G  L+E LD   P  R LT P       
Sbjct: 529 CSGLHGDNIARKSTEQA--AAWYT--------GPTLVEELDHSEPVTRALTKPLRLTIGD 578

Query: 796 IXNSVVXVPCP-SGRI 840
           I    V  P   SGRI
Sbjct: 579 IFRGGVQNPLSISGRI 594



 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 35/65 (53%), Positives = 45/65 (69%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 227
           K K   N VVIGHVD+GKST  G L+Y    +D+RT++++ KEA+ MGK SF  AWVLD+
Sbjct: 343 KSKNAANFVVIGHVDAGKSTLMGRLLYDLKVVDQRTVDRYRKEAEAMGKSSFALAWVLDQ 402

Query: 228 LKAER 242
              ER
Sbjct: 403 GTEER 407


>UniRef50_P50257 Cluster: Elongation factor 1-alpha S; n=1; Porphyra
           purpurea|Rep: Elongation factor 1-alpha S - Porphyra
           purpurea
          Length = 515

 Score =  130 bits (314), Expect = 5e-29
 Identities = 61/93 (65%), Positives = 73/93 (78%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIALWKF T+K+  T+IDAPGHRDFIKNMITGTSQAD A+L++      FEAGI++ G 
Sbjct: 73  IDIALWKFSTAKFEYTVIDAPGHRDFIKNMITGTSQADVALLVIDG--NNFEAGIAEGGS 130

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSP 534
           T+EHALLA+TLGVKQL VG+NKMD +      P
Sbjct: 131 TKEHALLAYTLGVKQLAVGINKMDDVKDKDGGP 163



 Score =  129 bits (312), Expect = 8e-29
 Identities = 59/68 (86%), Positives = 63/68 (92%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           MGKEKTHIN+VVIGHVD+GKSTTTGHLIYK GGID RTI KFE +A+EMGK SFKYAWVL
Sbjct: 1   MGKEKTHINLVVIGHVDAGKSTTTGHLIYKLGGIDARTIAKFEADAKEMGKSSFKYAWVL 60

Query: 222 DKLKAERE 245
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>UniRef50_UPI00006CC36B Cluster: Elongation factor Tu C-terminal
           domain containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 441

 Score =  129 bits (311), Expect = 1e-28
 Identities = 56/145 (38%), Positives = 89/145 (61%)
 Frame = +1

Query: 247 RYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 426
           +  ID +++ FET K+ +TIID PG   + KNM+TG   AD AVL+++A   EFE G  K
Sbjct: 74  KQSIDTSIFHFETDKFQITIIDTPGDTQYTKNMMTGICLADAAVLMISAAADEFEKGFGK 133

Query: 427 NGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVA 606
           +GQT++  L ++ LG+KQ+IV +NKMD   +        + +++      ++ +N   + 
Sbjct: 134 DGQTKDFILHSYALGIKQMIVCINKMDDSKYSFCQKRFNEIKKEVKQQFEKINFNLQNIK 193

Query: 607 FVPISGWHGDNMLEPSTKMPWFKGW 681
           F+PIS + GDN+LE S  MPW+  +
Sbjct: 194 FIPISAFLGDNLLEKSPNMPWYNSF 218



 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 21/66 (31%), Positives = 42/66 (63%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 227
           ++K  I + VIG++ SGKST  GHL  + G ++ + +++ ++  +E G+    Y++++D 
Sbjct: 7   QKKERITLAVIGNIGSGKSTMCGHLAIQLGQVNDQKLKEVKQACEEEGQDGINYSYIMDT 66

Query: 228 LKAERE 245
            K ER+
Sbjct: 67  KKVERQ 72


>UniRef50_A2AX44 Cluster: Translation elongation factor 1 like;
           n=37; Eukaryota|Rep: Translation elongation factor 1
           like - Guillardia theta (Cryptomonas phi)
          Length = 472

 Score =  128 bits (308), Expect = 2e-28
 Identities = 80/186 (43%), Positives = 107/186 (57%), Gaps = 15/186 (8%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK--------N 429
           +F T K++ TIIDAPGHRDFIKNMI+G++QAD A+L+V A  G F   I K         
Sbjct: 78  EFFTDKWHYTIIDAPGHRDFIKNMISGSAQADVALLMVPA-DGNFTTAIQKGDAKAGEIQ 136

Query: 430 GQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYN----PA 597
           GQTR+HA +   LG+KQLIVG+NKMDS           + R +  +   R+G+      A
Sbjct: 137 GQTRQHARILNLLGIKQLIVGINKMDSDTAGYKEERYNEIRDEMRNMLIRVGWKKEFVAA 196

Query: 598 AVAFVPISGWHGDNMLEPSTKMPWFKGWQV--ERKEGKADGKCLIEAL-DAILPPARPLT 768
           +V  +PISGW GDN+L  ST M W+ G +V  +    K   + L+ AL D   PP R + 
Sbjct: 197 SVPVIPISGWMGDNLLTKSTNMGWWSGVEVVPDGSTDKMKIETLLHALNDFARPPKRNVD 256

Query: 769 SPCVFP 786
           +P   P
Sbjct: 257 APMRCP 262



 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 36/65 (55%), Positives = 51/65 (78%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           EK H++IV+ GHVDSGKSTTTG L+++ GGI +R +EK ++EA  +GK SF +A+ +D+ 
Sbjct: 3   EKEHLSIVICGHVDSGKSTTTGRLLFELGGIPERELEKLKEEAANLGKSSFAFAFYMDRQ 62

Query: 231 KAERE 245
           K ERE
Sbjct: 63  KEERE 67


>UniRef50_A5JHE1 Cluster: Translation elongation factor EF-1 alpha
           subunit; n=2; Euryarchaeota|Rep: Translation elongation
           factor EF-1 alpha subunit - Methanohalophilus
           portucalensis
          Length = 354

 Score =  127 bits (307), Expect = 3e-28
 Identities = 64/141 (45%), Positives = 87/141 (61%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIA  +F+T KYY TI+D PGHRDF+KNMITG SQAD AVL+VAA  G          Q
Sbjct: 51  IDIAHKRFDTDKYYFTIVDCPGHRDFVKNMITGASQADAAVLVVAATDGVM-------AQ 103

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+EH  L+ TLG+ QLI+ VNKMD+ ++        + ++        +G+  A V F+P
Sbjct: 104 TKEHVFLSRTLGINQLIIAVNKMDATDYS--EDKYNQVKKDVSELLGMVGFKAADVPFIP 161

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
            S + GDN+ + S+  PW+ G
Sbjct: 162 TSAFEGDNISKNSSNTPWYNG 182



 Score = 53.6 bits (123), Expect = 6e-06
 Identities = 23/42 (54%), Positives = 30/42 (71%)
 Frame = +3

Query: 120 LIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           L+Y  G I +  I+KF +EA+E GK SF +AWV+D LK ERE
Sbjct: 5   LLYXTGAIPQHIIDKFREEAKEKGKESFAFAWVMDSLKEERE 46


>UniRef50_Q259E7 Cluster: H0801D08.2 protein; n=5; Oryza sativa|Rep:
           H0801D08.2 protein - Oryza sativa (Rice)
          Length = 654

 Score =  126 bits (305), Expect = 6e-28
 Identities = 68/179 (37%), Positives = 105/179 (58%), Gaps = 2/179 (1%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKN--GQTREHA 450
           F+T  Y+V ++D+PGH+DF+ NMI+G +Q+D A+L++ A  G FEAG+  N  GQT+EH+
Sbjct: 307 FDTKNYHVVLLDSPGHKDFVPNMISGATQSDAAILVIDASIGSFEAGMGINGIGQTKEHS 366

Query: 451 LLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWH 630
            L  + GV  LIV VNKMDS+ +     +  KS  +     R  GY  +AVA+VPIS   
Sbjct: 367 QLVRSFGVDNLIVVVNKMDSVEYSKERFNFIKS--QLGAFLRSCGYKDSAVAWVPISAME 424

Query: 631 GDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARRIXNS 807
            +N++  ++       W         DG CL++A+D + PP+R ++ P   P   + +S
Sbjct: 425 NENLMTTASDTR-LSSWY--------DGNCLLKAIDTLPPPSRDVSKPLRLPICDVFSS 474


>UniRef50_Q5KLM5 Cluster: Putative uncharacterized protein; n=2;
            Filobasidiella neoformans|Rep: Putative uncharacterized
            protein - Cryptococcus neoformans (Filobasidiella
            neoformans)
          Length = 914

 Score =  125 bits (302), Expect = 1e-27
 Identities = 73/182 (40%), Positives = 102/182 (56%), Gaps = 1/182 (0%)
 Frame = +1

Query: 256  IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
            IDIA   F T     T++DAPGHRDFI  MI+G +QAD A+L++    GEFEAG  + GQ
Sbjct: 549  IDIATTHFVTPHRNFTLLDAPGHRDFIPAMISGAAQADVALLVIDGSPGEFEAGFERGGQ 608

Query: 436  TREHALLAFTLGVKQLIVGVNKMDSLN-HHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFV 612
            TREHA L  +LGVK++IVGVNKMD ++       ++ +S + +  ++   G+N     F+
Sbjct: 609  TREHAWLVRSLGVKEIIVGVNKMDLVSWSQDRYEEIVESLKPFLLSA---GFNSTKTTFL 665

Query: 613  PISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPAR 792
            P++   G N+L+     P  K W          G  LI+ALD +  P RP  SP   P  
Sbjct: 666  PLAAMEGINILD--NDQPELKKWY--------SGPALIDALDDVEVPTRPYDSPLRIPLS 715

Query: 793  RI 798
             +
Sbjct: 716  NV 717



 Score = 63.7 bits (148), Expect = 6e-09
 Identities = 26/64 (40%), Positives = 45/64 (70%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K +++++V+GHVD+GKST  G ++Y  G + ++     E+ ++++GKGSF +AW LD L 
Sbjct: 481 KKNVSLIVVGHVDAGKSTLMGRVLYDIGELSEKEKIANERGSKKLGKGSFAFAWGLDALG 540

Query: 234 AERE 245
            ER+
Sbjct: 541 DERD 544


>UniRef50_Q4P6P7 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 965

 Score =  124 bits (300), Expect = 2e-27
 Identities = 77/181 (42%), Positives = 100/181 (55%)
 Frame = +1

Query: 256  IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
            IDIA   F T     T++DAPGHRDFI NMI+G +QAD A+L+V +  G FEAG   NGQ
Sbjct: 595  IDIAQDHFSTQHRTFTLLDAPGHRDFIPNMISGAAQADSALLVVDSIQGAFEAGFGPNGQ 654

Query: 436  TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
            TREHALL  +LGV+QL+V VNK+D++ +     D    + K P      G++ A + FVP
Sbjct: 655  TREHALLVRSLGVQQLVVVVNKLDAVGYSQERYDEIVGKVK-PFL-MSCGFDAAKLRFVP 712

Query: 616  ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
              G  G+N L    +      W          G  L+E LD + PPAR L SP   P   
Sbjct: 713  CGGSVGEN-LAVRERGGALSAWY--------SGPTLVELLDELEPPARQLDSPLRLPVTN 763

Query: 796  I 798
            +
Sbjct: 764  V 764



 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 32/76 (42%), Positives = 50/76 (65%), Gaps = 1/76 (1%)
 Frame = +3

Query: 21  VIRD*PKMGKE-KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKG 197
           +I +  K  +E K  +++VV+GHVD+GKST  G ++ + G + +R     E+ +Q++GKG
Sbjct: 515 IIEEYRKREREGKAELSLVVVGHVDAGKSTLMGRMLLELGSLSQREYSTNERASQKIGKG 574

Query: 198 SFKYAWVLDKLKAERE 245
           SF YAW LD  + ERE
Sbjct: 575 SFAYAWALDSSEEERE 590


>UniRef50_A7D4X8 Cluster: Translation elongation factor EF-1,
           subunit alpha; n=1; Halorubrum lacusprofundi ATCC
           49239|Rep: Translation elongation factor EF-1, subunit
           alpha - Halorubrum lacusprofundi ATCC 49239
          Length = 540

 Score =  124 bits (300), Expect = 2e-27
 Identities = 76/195 (38%), Positives = 107/195 (54%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIA  +F+T  YY TI+D PGHRDF+KNMITG SQAD AVL+VAA     + G++   Q
Sbjct: 191 IDIAHQEFDTDNYYFTIVDCPGHRDFVKNMITGASQADNAVLVVAA-----DDGVAP--Q 243

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREH  LA TLG+ ++I+GVNKMD +++   S D  +   +      ++ +      FVP
Sbjct: 244 TREHVFLARTLGINEIIIGVNKMDLVDYKESSYD--QVVEEVNDLLNQVRFATDDTTFVP 301

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           IS + GDN+ E S   PW+            DG  L+E+L+ +     P  +P   P + 
Sbjct: 302 ISAFEGDNISEESENTPWY------------DGPTLLESLNDLPESEPPTDAPLRLPIQD 349

Query: 796 IXNSVVXVPCPSGRI 840
           +         P GR+
Sbjct: 350 VYTISGIGTVPVGRV 364



 Score = 77.0 bits (181), Expect = 6e-13
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +3

Query: 9   YTQFVI-RD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE 185
           Y+Q  + RD P    +K H N+ +IGHVD GKST  G L+++ G + +  IE+  +EA+E
Sbjct: 109 YSQSALARDYPM--SDKPHQNLAIIGHVDHGKSTLVGRLLFETGSVPEHVIEQHREEAEE 166

Query: 186 MGKGSFKYAWVLDKLKAERE 245
            GKG F++A+V+D L  ERE
Sbjct: 167 KGKGGFEFAYVMDNLAEERE 186


>UniRef50_Q23TC1 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 600

 Score =  122 bits (294), Expect = 1e-26
 Identities = 73/188 (38%), Positives = 104/188 (55%), Gaps = 3/188 (1%)
 Frame = +1

Query: 220 WTN*RLSVXRYQ---IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVA 390
           W N      R +   IDI     +T    +T +DAPGH+DF+ NMI G +QAD A+L++ 
Sbjct: 229 WVNDEFEAERQRGITIDIGYKVIQTKNKNITFLDAPGHKDFVPNMIQGVTQADYALLVIE 288

Query: 391 AGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHT 570
                FE G    GQT+EHA L   LGV++LIV +NKMD++N      +  K       T
Sbjct: 289 GSLQAFERGFEFGGQTKEHAFLVKQLGVQRLIVLINKMDTVNWDRNRFEYIKLELTRFLT 348

Query: 571 SRRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILP 750
           S  +GY+   + FVPIS ++ +N++E S K+P   GW         +GKCL+E LD +  
Sbjct: 349 S--IGYSEDNLIFVPISAFYAENIVEKS-KLP-EAGWY--------EGKCLMELLDTLPV 396

Query: 751 PARPLTSP 774
           P RP+ +P
Sbjct: 397 PTRPVNTP 404



 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 32/62 (51%), Positives = 47/62 (75%)
 Frame = +3

Query: 60  HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 239
           ++N+V++GHVDSGKST  GHL +    ID++   K EKE++ +GK SFK+AWV D+ +AE
Sbjct: 178 NMNLVIVGHVDSGKSTLVGHLCHLKKVIDQKLAHKNEKESKNIGKESFKFAWVNDEFEAE 237

Query: 240 RE 245
           R+
Sbjct: 238 RQ 239


>UniRef50_A2QW82 Cluster: Contig An11c0160, complete genome; n=8;
           Eurotiomycetidae|Rep: Contig An11c0160, complete genome
           - Aspergillus niger
          Length = 809

 Score =  120 bits (290), Expect = 4e-26
 Identities = 64/143 (44%), Positives = 87/143 (60%), Gaps = 2/143 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIA  KFET     TI+DAPGHRDF+ NMI G SQAD AVL++ +  G FE+G+   GQ
Sbjct: 467 IDIATNKFETESTVFTIVDAPGHRDFVPNMIAGASQADFAVLVIDSSIGNFESGL--KGQ 524

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+EHALL  ++GV+++I+ VNKMDS+          +  ++        G+    +AFVP
Sbjct: 525 TKEHALLVRSMGVQRIIIAVNKMDSVQWD--QGRFEEIEQQVSSFLTTAGFQAKNIAFVP 582

Query: 616 ISGWHGDNMLEPS--TKMPWFKG 678
            SG  GDN+   S    + W+KG
Sbjct: 583 CSGISGDNVTRRSEDPNVSWYKG 605



 Score = 76.6 bits (180), Expect = 8e-13
 Identities = 34/65 (52%), Positives = 46/65 (70%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 227
           + K  +N  VIGHVD+GKST  G L+     +D+RT+EK+ KEA+++GKGSF  AWVLD+
Sbjct: 397 QRKKAMNFAVIGHVDAGKSTLMGRLLADLKAVDQRTLEKYRKEAEKIGKGSFALAWVLDQ 456

Query: 228 LKAER 242
              ER
Sbjct: 457 GSEER 461


>UniRef50_Q8IIC9 Cluster: Translation elongation factor EF-1,
           subunit alpha, putative; n=11; Apicomplexa|Rep:
           Translation elongation factor EF-1, subunit alpha,
           putative - Plasmodium falciparum (isolate 3D7)
          Length = 555

 Score =  120 bits (288), Expect = 6e-26
 Identities = 62/132 (46%), Positives = 81/132 (61%), Gaps = 1/132 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET     TI+DAPGH++FI NMI+G +QAD  VLI++A  GEFE G  + GQ
Sbjct: 185 VEVGRAHFETKDRRFTILDAPGHKNFIPNMISGAAQADIGVLIISARKGEFETGFERGGQ 244

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYN-PAAVAFV 612
           TREH LLA TLG+ QLIV +NKMD    +       + ++K     +  GYN    V FV
Sbjct: 245 TREHTLLARTLGINQLIVAINKMDDPTCNWSESRYEEIQKKITPYIKSCGYNINKDVFFV 304

Query: 613 PISGWHGDNMLE 648
           PISG  G N+ E
Sbjct: 305 PISGLTGQNLSE 316



 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 30/64 (46%), Positives = 48/64 (75%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           + H+NI+ IGHVD+GKST  G+++Y  G +D RTIEK+E+EA+E  + S+  A+++D  +
Sbjct: 117 RPHLNIIFIGHVDAGKSTACGNILYILGYVDDRTIEKYEREAKEKSRESWFLAFIMDINE 176

Query: 234 AERE 245
            ER+
Sbjct: 177 EERQ 180


>UniRef50_Q7YZN7 Cluster: Hsp70 subfamily B suppressor 1; n=3;
           Dictyostelium discoideum|Rep: Hsp70 subfamily B
           suppressor 1 - Dictyostelium discoideum (Slime mold)
          Length = 317

 Score =  119 bits (287), Expect = 9e-26
 Identities = 64/145 (44%), Positives = 91/145 (62%), Gaps = 2/145 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+ +  FET    +T++DAPGHRDFI NMI+GT+QAD A+L++ A   EFEAG S  GQ
Sbjct: 54  MDVCVRYFETEHRRITLLDAPGHRDFIPNMISGTTQADVAILLINA--SEFEAGFSAEGQ 111

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+EHALLA +LG+ +LIV VNKMDS+       D      K      +  +N   + F+P
Sbjct: 112 TKEHALLAKSLGIMELIVAVNKMDSIEWDQSRYDYIVETIKTFLVHAK--FNEKNIRFIP 169

Query: 616 ISGWHGDNML--EPSTKMPWFKGWQ 684
           ISG+ G+N++  + S  + W+   Q
Sbjct: 170 ISGFTGENLIDRQESKLLKWYDSKQ 194



 Score = 70.1 bits (164), Expect = 7e-11
 Identities = 29/49 (59%), Positives = 38/49 (77%)
 Frame = +3

Query: 99  KSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           KSTT GH+++K G +DKRT+ KFE E+  MGK SF +AWVLD+ + ERE
Sbjct: 1   KSTTMGHILFKLGYVDKRTMSKFENESNRMGKSSFHFAWVLDEQEEERE 49


>UniRef50_A6RA16 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 957

 Score =  119 bits (286), Expect = 1e-25
 Identities = 63/144 (43%), Positives = 91/144 (63%), Gaps = 3/144 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIA  +F T     TI+DAPGHRDF+ NMI G SQAD AVL++ A TG FE+G+   GQ
Sbjct: 489 IDIATNRFATENTNFTILDAPGHRDFVPNMIAGASQADFAVLVLDATTGNFESGL--RGQ 546

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLN-HHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFV 612
           T+EHALL  ++GV++++V VNKMD+    H    ++++    +  T+   G+    ++FV
Sbjct: 547 TKEHALLVRSMGVQRIVVAVNKMDAAGWSHDRFDEIQQQTASFLTTA---GFQAKNISFV 603

Query: 613 PISGWHGDNMLEPS--TKMPWFKG 678
           P SG  GDN+ + +  T   W+ G
Sbjct: 604 PCSGLRGDNVAQRAHDTNASWYTG 627



 Score = 79.8 bits (188), Expect = 8e-14
 Identities = 35/65 (53%), Positives = 47/65 (72%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 227
           + K   N VVIGHVD+GKST  G L+Y+   +D+RTI++++KEA  +GKGSF  AWVLD+
Sbjct: 419 ERKKAANFVVIGHVDAGKSTLMGRLLYELKAVDQRTIDRYQKEADRIGKGSFALAWVLDQ 478

Query: 228 LKAER 242
              ER
Sbjct: 479 GSEER 483


>UniRef50_O45622 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 532

 Score =  118 bits (285), Expect = 1e-25
 Identities = 65/166 (39%), Positives = 91/166 (54%), Gaps = 1/166 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET K + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE G  + GQ
Sbjct: 175 VEVGRAYFETEKRHFTILDAPGHKSFVPNMIVGANQADLAVLVISARRGEFETGFDRGGQ 234

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           TREH++L  T GVK L++ VNKMD           ++   K     R+LG+NP   + +V
Sbjct: 235 TREHSMLVKTAGVKHLVILVNKMDDPTVKWEEERFKEIEGKLTPFLRKLGFNPKTDITYV 294

Query: 613 PISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILP 750
           P SG  G  + +  T       W          G C IE +D +LP
Sbjct: 295 PCSGLTGAFIKDRPTGSE--GNWY--------SGPCFIEFIDVLLP 330



 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 34/67 (50%), Positives = 48/67 (71%)
 Frame = +3

Query: 45  GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 224
           G  K HIN+V +GHVD+GKST  G L++  G +DKRT+EK+E+EA+E G+ S+  +W +D
Sbjct: 104 GTHKEHINMVFVGHVDAGKSTIGGQLMFLTGMVDKRTLEKYEREAKEKGRESWYLSWCMD 163

Query: 225 KLKAERE 245
               ERE
Sbjct: 164 TNDEERE 170


>UniRef50_Q9NCN7 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Trichomonas vaginalis|Rep: Eukaryotic
           release factor 3 GTPase subunit - Trichomonas vaginalis
          Length = 587

 Score =  116 bits (280), Expect = 6e-25
 Identities = 64/177 (36%), Positives = 94/177 (53%), Gaps = 1/177 (0%)
 Frame = +1

Query: 259 DIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 438
           ++ +  FET++   TI+DAPGHR ++  MI G  QAD AVL+++A  GEFEAG    GQT
Sbjct: 229 EVGVAHFETAQNKYTILDAPGHRSYVPQMIGGAVQADVAVLVISARNGEFEAGFENGGQT 288

Query: 439 REHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKY-PHTSRRLGYNPAAVAFVP 615
            EH L+A T GV+++I+ VNKMD            +   K+ P   R +G+      ++P
Sbjct: 289 SEHLLIARTAGVREIIIVVNKMDDPTVKWSKERFDQIVTKFTPFIEREIGFKKDQYTYIP 348

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFP 786
           I+   G N+ + S + PW+            +G  L E LD++ PP R  T     P
Sbjct: 349 IAALTGFNLKQRSNECPWY------------NGPTLFEKLDSLKPPVRNETDSFRLP 393



 Score = 81.4 bits (192), Expect = 3e-14
 Identities = 33/63 (52%), Positives = 49/63 (77%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K H NIV IGHVD+GKST  GH++Y+ G +D+RTIE+++ E+ + G+GS+ ++WV+D  K
Sbjct: 160 KKHFNIVFIGHVDAGKSTLCGHVLYQAGCVDQRTIEQYQAESAKEGRGSWYFSWVMDLSK 219

Query: 234 AER 242
            ER
Sbjct: 220 EER 222


>UniRef50_Q6BVD7 Cluster: Similar to sp|P32769 Saccharomyces
           cerevisiae YKR084c HBS1; n=5; Saccharomycetales|Rep:
           Similar to sp|P32769 Saccharomyces cerevisiae YKR084c
           HBS1 - Debaryomyces hansenii (Yeast) (Torulaspora
           hansenii)
          Length = 600

 Score =  116 bits (280), Expect = 6e-25
 Identities = 61/144 (42%), Positives = 88/144 (61%), Gaps = 3/144 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +DI    FET     T IDAPGH+DF+  MI+G SQAD A+L++ + TGEFE+G + +GQ
Sbjct: 232 VDICATNFETETSRFTAIDAPGHKDFVPQMISGVSQADFALLVIDSITGEFESGFTMDGQ 291

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+EH +LA  LG+ +L V VNKMD  N      +  K +     T   +G++   + FVP
Sbjct: 292 TKEHTILAKNLGIARLCVVVNKMDKENWSERRFEDIKFQMTEFLTGSDIGFSSDQIDFVP 351

Query: 616 ISGWHGDNMLEPSTKM---PWFKG 678
           ISG  G+N+++  T +    W+KG
Sbjct: 352 ISGLTGNNVVKTDTTIKAFDWYKG 375



 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 29/63 (46%), Positives = 44/63 (69%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K H + VVIGHVD+GKST  G L++  G ID +T+    ++++++GKGSF  AW++D+  
Sbjct: 164 KPHKSFVVIGHVDAGKSTLMGRLLFDLGVIDAKTVNNLVRQSEKIGKGSFALAWIMDQTS 223

Query: 234 AER 242
            ER
Sbjct: 224 EER 226


>UniRef50_A3LY56 Cluster: Predicted protein; n=2; Pichia|Rep:
           Predicted protein - Pichia stipitis (Yeast)
          Length = 581

 Score =  116 bits (278), Expect = 1e-24
 Identities = 60/144 (41%), Positives = 89/144 (61%), Gaps = 3/144 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +DI    FET     T IDAPGH+DF+  MI G SQAD A+L+V + TGEFEAG + +GQ
Sbjct: 213 VDICATDFETPTTRFTAIDAPGHKDFVPQMIGGVSQADLALLVVDSITGEFEAGFAMDGQ 272

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+EH +LA  LG++++ V VNK+D  + +    +  K++     TS  + +    + FVP
Sbjct: 273 TKEHTILAKNLGIERICVAVNKLDKEDWNEERFESIKTQLTEYLTSDEVQFAEEQIDFVP 332

Query: 616 ISGWHGDNMLEPSTKMP---WFKG 678
           ISG  G+N+++  T +    W+KG
Sbjct: 333 ISGLSGNNVVKRDTSIAAFNWYKG 356



 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 31/63 (49%), Positives = 43/63 (68%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K H + VVIGHVD+GKST  G +++  G +D RT+ +  KEA+  GKGSF  AW++D+  
Sbjct: 145 KPHKSFVVIGHVDAGKSTLMGRILFDYGIVDARTVNRLVKEAENAGKGSFALAWIMDQTA 204

Query: 234 AER 242
            ER
Sbjct: 205 EER 207


>UniRef50_UPI0000DD78A4 Cluster: PREDICTED: similar to statin-like;
           n=1; Homo sapiens|Rep: PREDICTED: similar to statin-like
           - Homo sapiens
          Length = 254

 Score =  115 bits (277), Expect = 1e-24
 Identities = 57/102 (55%), Positives = 69/102 (67%)
 Frame = +1

Query: 355 TSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSP 534
           + Q DCAVLIVA+G GE EAGISKN Q  EH LLA+TLG+KQLIV VNKMD       S 
Sbjct: 44  SGQEDCAVLIVASGVGECEAGISKNKQICEHTLLAYTLGMKQLIVTVNKMDITEPPYSST 103

Query: 535 DLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPSTK 660
              +  ++     +++ YN   + FVPISGWHGDNMLEP +K
Sbjct: 104 CFEEISKEVKAYIKKISYNSQTLPFVPISGWHGDNMLEPGSK 145


>UniRef50_A4ZCD1 Cluster: GTP-binding protein; n=9;
           Magnoliophyta|Rep: GTP-binding protein - Triticum
           aestivum (Wheat)
          Length = 533

 Score =  115 bits (277), Expect = 1e-24
 Identities = 72/178 (40%), Positives = 90/178 (50%), Gaps = 1/178 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET     TI+DAPGH+ ++ NMI+G SQAD  VL+++A  GEFE G  + GQ
Sbjct: 158 VEVGRAHFETENTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGYERGGQ 217

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYN-PAAVAFV 612
           TREH LLA TLGV +L+V +NKMD            +   K     R  GYN    V F+
Sbjct: 218 TREHVLLAKTLGVAKLVVVINKMDEPTVQWSKERYDEIEGKMIPFLRSSGYNVKKDVQFL 277

Query: 613 PISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFP 786
           PISG  G NM     K      W         +G CL E LD I  P R    P   P
Sbjct: 278 PISGLCGANMKTRMDKS--ICSWW--------NGPCLFEILDKIEVPLRDPKGPVRLP 325



 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 31/65 (47%), Positives = 48/65 (73%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 227
           +EK HIN+V IGHVD+GKST  G +++  G +D RTI+K+EKEA++  + S+  A+++D 
Sbjct: 88  EEKRHINLVFIGHVDAGKSTAGGQILFLSGQVDDRTIQKYEKEAKDKSRESWYMAYIMDT 147

Query: 228 LKAER 242
            + ER
Sbjct: 148 NEEER 152


>UniRef50_Q96WS7 Cluster: Eukaryotic release factor 3; n=1;
           Pneumocystis carinii|Rep: Eukaryotic release factor 3 -
           Pneumocystis carinii
          Length = 629

 Score =  115 bits (277), Expect = 1e-24
 Identities = 63/145 (43%), Positives = 87/145 (60%), Gaps = 11/145 (7%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 456
           FET K   TI+DAPGH+ ++ NMI GT+QA+ AVL+++A  GE+E G  K GQTREHA+L
Sbjct: 275 FETEKRRYTILDAPGHKSYVPNMIEGTAQAEVAVLVISARKGEYETGFEKGGQTREHAML 334

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTS--------RRLGYNPAA-VAF 609
           + T GV +LIV +NKMD        P +  S+ +Y   +        + +GYNP     F
Sbjct: 335 SKTQGVSKLIVAINKMD-------DPTVEWSKERYDECTNGITTFLRKEVGYNPKTDFVF 387

Query: 610 VPISGWHGDNMLEPSTK--MPWFKG 678
           +PIS + G N+ E   K   PW+ G
Sbjct: 388 MPISAFTGINIKERIDKKICPWYNG 412



 Score = 82.2 bits (194), Expect = 2e-14
 Identities = 34/63 (53%), Positives = 48/63 (76%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K H+N+V IGHVD+GKST  G+++Y  G +DKRT+EK+EK+A+E G+ S+  +W LD  K
Sbjct: 200 KEHVNVVFIGHVDAGKSTLGGNILYMTGMVDKRTMEKYEKDAKEAGRESWYLSWALDSTK 259

Query: 234 AER 242
            ER
Sbjct: 260 EER 262


>UniRef50_Q9NCN8 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Giardia intestinalis|Rep: Eukaryotic
           release factor 3 GTPase subunit - Giardia lamblia
           (Giardia intestinalis)
          Length = 465

 Score =  115 bits (276), Expect = 2e-24
 Identities = 62/184 (33%), Positives = 96/184 (52%), Gaps = 3/184 (1%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           +TIIDAPGH+ F+ NMI+G +QAD A+L+++A  GEFE+G  + GQT EHALLA+  G+K
Sbjct: 97  ITIIDAPGHKGFVHNMISGAAQADTAILVISARKGEFESGFERGGQTSEHALLAYVNGIK 156

Query: 478 QLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPST 657
           Q++  +NKMD +              +       +GY    + F+PISG+ G+N++    
Sbjct: 157 QIVCLINKMDDITVEYCKKRYDSIVSQLKLYLENVGYASKNIFFLPISGFTGENLISTKE 216

Query: 658 KMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP---CVFPARRIXNSVVXVPCP 828
             P    W          G   ++ LD +  P R   SP   CV    +  ++ + V   
Sbjct: 217 LNPKLSEWY--------SGPSFLDLLDELKVPKRDTKSPLCACVSGHYKENSAFIVVKVE 268

Query: 829 SGRI 840
            G++
Sbjct: 269 QGKM 272



 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 33/76 (43%), Positives = 53/76 (69%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 227
           +++ ++NIV IGHVD+GKST +GHL+   G +DKR +EK E++A+ + + S+KYA+ +D 
Sbjct: 12  EKRKNLNIVFIGHVDAGKSTISGHLVSDLGKLDKRQLEKLEQQAKALNRESWKYAFAMDT 71

Query: 228 LKAEREXVSNRYCSLE 275
            + ERE      C+ E
Sbjct: 72  SEEEREKGKTVECARE 87


>UniRef50_Q9HGI4 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=2; Zygosaccharomyces rouxii|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Zygosaccharomyces rouxii (Candida mogii)
          Length = 662

 Score =  113 bits (273), Expect = 4e-24
 Identities = 66/181 (36%), Positives = 99/181 (54%), Gaps = 4/181 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I++    FET K   TI+DAPGH+ ++  MI G SQAD  +L+++A  GE+E G  K GQ
Sbjct: 303 IEVGRAYFETEKRRYTILDAPGHKMYVSEMIGGASQADVGILVISARKGEYETGFEKGGQ 362

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYN-PAAVAFV 612
           TREHALLA T GV +LIV +NKMD    +       +  +   +  + +GYN    V F+
Sbjct: 363 TREHALLAKTQGVNKLIVTINKMDDPTVNWSKERYDQCVKNLSNFLKAIGYNVKEEVVFM 422

Query: 613 PISGWHGDNM---LEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVF 783
           P+SG+ G  +   ++P  + PW+            DG  L+E +D +    R + +P + 
Sbjct: 423 PVSGYSGAGLGTRVDPK-ECPWY------------DGPALLEYMDNMSHVDRKMNAPFML 469

Query: 784 P 786
           P
Sbjct: 470 P 470



 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 30/64 (46%), Positives = 49/64 (76%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K H++I+ +GHVD+GKST  G+++Y  G +DKRT+EK+E+EA++ GK  +  +WV+D  +
Sbjct: 235 KDHMSIIFMGHVDAGKSTMGGNILYMTGSVDKRTVEKYEREAKDAGKQGWYLSWVMDTNR 294

Query: 234 AERE 245
            ER+
Sbjct: 295 EERD 298


>UniRef50_P05453 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=50; Ascomycota|Rep: Eukaryotic
           peptide chain release factor GTP-binding subunit -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 685

 Score =  113 bits (273), Expect = 4e-24
 Identities = 59/144 (40%), Positives = 84/144 (58%), Gaps = 3/144 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I++    FET K   TI+DAPGH+ ++  MI G SQAD  VL+++A  GE+E G  + GQ
Sbjct: 326 IEVGKAYFETEKRRYTILDAPGHKMYVSEMIGGASQADVGVLVISARKGEYETGFERGGQ 385

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYN-PAAVAFV 612
           TREHALLA T GV +++V VNKMD    +       +      +  R +GYN    V F+
Sbjct: 386 TREHALLAKTQGVNKMVVVVNKMDDPTVNWSKERYDQCVSNVSNFLRAIGYNIKTDVVFM 445

Query: 613 PISGWHGDNMLE--PSTKMPWFKG 678
           P+SG+ G N+ +     + PW+ G
Sbjct: 446 PVSGYSGANLKDHVDPKECPWYTG 469



 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 31/63 (49%), Positives = 48/63 (76%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K H++++ +GHVD+GKST  G+L+Y  G +DKRTIEK+E+EA++ G+  +  +WV+D  K
Sbjct: 258 KDHVSLIFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRQGWYLSWVMDTNK 317

Query: 234 AER 242
            ER
Sbjct: 318 EER 320


>UniRef50_A4R2K6 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 630

 Score =  113 bits (272), Expect = 6e-24
 Identities = 60/143 (41%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDIA  +FET     TI+DAPGH+DF+ NMI G SQAD A+L++ A  G +E G+   GQ
Sbjct: 345 IDIAKSRFETESTIFTILDAPGHQDFVPNMIAGASQADFAILVIDATVGAYERGL--KGQ 402

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+EHA L  ++GV ++IV VNK+D+ N         +           LG+    ++F+P
Sbjct: 403 TKEHAQLIRSIGVSRIIVAVNKLDATNWS--QDRFNEISDGMSGFMSALGFQMKNISFIP 460

Query: 616 ISGWHGDNMLEPST--KMPWFKG 678
           +SG +GDNM++ ST     W+ G
Sbjct: 461 LSGLNGDNMVKRSTAEAASWYTG 483



 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 34/64 (53%), Positives = 44/64 (68%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           +K + + VV+GHVD+GKST  G L+     +D RTI K++KEA+ MGKGSF  AWVLD  
Sbjct: 276 KKKNASFVVVGHVDAGKSTMMGRLLLDMNVVDDRTISKYKKEAEAMGKGSFALAWVLDST 335

Query: 231 KAER 242
             ER
Sbjct: 336 SDER 339


>UniRef50_UPI0000499ED8 Cluster: guanine nucleotide regulatory
           protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep:
           guanine nucleotide regulatory protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 488

 Score =  113 bits (271), Expect = 7e-24
 Identities = 69/165 (41%), Positives = 90/165 (54%), Gaps = 2/165 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+    FET K   TI+DAPGHR F+ NMI+  +QAD AVLIV+A  GEFE G  K GQ
Sbjct: 127 IDVGRALFETEKRRYTILDAPGHRSFVPNMISAAAQADIAVLIVSARKGEFETGFDKGGQ 186

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREH+ L  T GVK +I+ VNKMD            +   K     R+ G++   +  +P
Sbjct: 187 TREHSQLCRTAGVKTVIIAVNKMDEKTVGWEKSRYDEIVNKVKPFLRQCGFSD--IYSIP 244

Query: 616 ISGWHGDNMLEPSTK--MPWFKGWQVERKEGKADGKCLIEALDAI 744
           ISG+ G N+ +   K    W+            DG CL+E LD+I
Sbjct: 245 ISGFSGLNLTKRLDKGVCSWY------------DGPCLVELLDSI 277



 Score = 70.9 bits (166), Expect = 4e-11
 Identities = 29/63 (46%), Positives = 50/63 (79%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K   NI+ IGHVD+GKSTT+G+++++ G I++R I+KFEKEA+E  + S+  A+++D+++
Sbjct: 59  KESANIIFIGHVDAGKSTTSGNILFQSGNIEQRIIDKFEKEAKENQRESWWLAYIMDQIE 118

Query: 234 AER 242
            E+
Sbjct: 119 EEK 121


>UniRef50_Q00WU5 Cluster: EF-1 alpha-like protein; n=1; Ostreococcus
           tauri|Rep: EF-1 alpha-like protein - Ostreococcus tauri
          Length = 444

 Score =  112 bits (269), Expect = 1e-23
 Identities = 66/142 (46%), Positives = 86/142 (60%), Gaps = 12/142 (8%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK--------N 429
           +F T K++ TIIDAPGHRDFIKNMI+G +QAD A+L+V A  G F   I K         
Sbjct: 86  EFFTEKWHYTIIDAPGHRDFIKNMISGAAQADVALLMVPA-DGNFTVAIQKGNHKAGEVQ 144

Query: 430 GQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLG----YNPA 597
           GQTR+HA L   LGVKQLI+G+NKMD            + R +  +   ++G    Y   
Sbjct: 145 GQTRQHARLLNLLGVKQLIIGINKMDCDMAGYKQERYEEIRNEMKNMLIKVGWKKDYVEK 204

Query: 598 AVAFVPISGWHGDNMLEPSTKM 663
           +V  +PISGW+GDN+L+ S KM
Sbjct: 205 SVPVLPISGWNGDNLLKKSEKM 226



 Score = 83.8 bits (198), Expect = 5e-15
 Identities = 36/68 (52%), Positives = 51/68 (75%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           M + K H++IV+ GHVDSGKSTTTG L+++ GGI +R +EK + EA  +GK SF +A+ +
Sbjct: 8   MSEGKEHLSIVICGHVDSGKSTTTGRLLFELGGIPERELEKLKAEADALGKSSFAFAFYM 67

Query: 222 DKLKAERE 245
           D+ K ERE
Sbjct: 68  DRQKEERE 75


>UniRef50_Q86NR4 Cluster: RE29053p; n=5; Diptera|Rep: RE29053p -
           Drosophila melanogaster (Fruit fly)
          Length = 670

 Score =  112 bits (269), Expect = 1e-23
 Identities = 67/195 (34%), Positives = 101/195 (51%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+   + ET    VT++DAPGH+DFI NMI+G +QAD A+L+V A  GEFE+G    GQ
Sbjct: 313 MDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFESGFELGGQ 372

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHA+L  +LGV QL V +NK+D++          +   K     +  G+  + V+F P
Sbjct: 373 TREHAILVRSLGVNQLGVVINKLDTVGWS--QDRFTEIVTKLKSFLKLAGFKDSDVSFTP 430

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
            SG  G+N+ + + + P    W          G+ L++ ++    P R +  P       
Sbjct: 431 CSGLTGENLTKKAQE-PALTNWY--------SGRHLLDVIENFKIPERAIDRPLRMSVSD 481

Query: 796 IXNSVVXVPCPSGRI 840
           I        C SGR+
Sbjct: 482 IYKGTGSGFCISGRV 496



 Score = 83.8 bits (198), Expect = 5e-15
 Identities = 34/64 (53%), Positives = 50/64 (78%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           +K+HI+++VIGHVD+GKST  GHL+Y  G + +R + K E+E++++GK SF YAWVLD+ 
Sbjct: 244 QKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDET 303

Query: 231 KAER 242
             ER
Sbjct: 304 GEER 307


>UniRef50_O74718 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=2; Schizosaccharomyces pombe|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Schizosaccharomyces pombe (Fission yeast)
          Length = 662

 Score =  111 bits (268), Expect = 2e-23
 Identities = 57/145 (39%), Positives = 87/145 (60%), Gaps = 4/145 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET     +++DAPGH+ ++ NMI G SQAD  VL+++A  GEFEAG  + GQ
Sbjct: 304 VEVGRAYFETEHRRFSLLDAPGHKGYVTNMINGASQADIGVLVISARRGEFEAGFERGGQ 363

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRL-GYNPAA-VAF 609
           TREHA+LA T G+  L+V +NKMD  +        ++   K     RR+ GYN    V +
Sbjct: 364 TREHAVLARTQGINHLVVVINKMDEPSVQWSEERYKECVDKLSMFLRRVAGYNSKTDVKY 423

Query: 610 VPISGWHGDNMLE--PSTKMPWFKG 678
           +P+S + G N+ +   S+  PW++G
Sbjct: 424 MPVSAYTGQNVKDRVDSSVCPWYQG 448



 Score = 80.6 bits (190), Expect = 5e-14
 Identities = 35/64 (54%), Positives = 47/64 (73%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K H+NIV IGHVD+GKST  G++++  G +DKRT+EK E+EA+E GK S+  +W LD   
Sbjct: 236 KEHVNIVFIGHVDAGKSTLGGNILFLTGMVDKRTMEKIEREAKEAGKESWYLSWALDSTS 295

Query: 234 AERE 245
            ERE
Sbjct: 296 EERE 299


>UniRef50_Q4QGW5 Cluster: Eukaryotic release factor 3, putative;
           n=8; Trypanosomatidae|Rep: Eukaryotic release factor 3,
           putative - Leishmania major
          Length = 763

 Score =  111 bits (267), Expect = 2e-23
 Identities = 62/140 (44%), Positives = 86/140 (61%), Gaps = 6/140 (4%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 456
           FET K  VT++DAPGH+ F+ +MI G +QAD  VL++++ TGEFE G  K GQTREHA+L
Sbjct: 399 FETEKRRVTVLDAPGHKAFVPSMIGGATQADICVLVISSRTGEFETGFEKGGQTREHAML 458

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA---VAFVPISGW 627
             T GVKQ+I  +NKMD +            R K P   R+ GY+      + F+P++G 
Sbjct: 459 VRTCGVKQMICVINKMDEMKWSKERYSEIVGRLK-PFL-RQNGYDEERAKNLIFMPVAGL 516

Query: 628 HGDNML---EPSTKMPWFKG 678
            G+N++   EPS    W+KG
Sbjct: 517 TGENLIKHVEPS-HCDWYKG 535



 Score = 64.1 bits (149), Expect = 4e-09
 Identities = 28/63 (44%), Positives = 44/63 (69%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           + H NIV  GHVD+GKST +GHL+ + G +D+R +EK  +EA+   +  ++YA+V+D  +
Sbjct: 324 RPHFNIVFCGHVDAGKSTISGHLLMEKGLVDQREMEKLRREAEINHREGWEYAYVMDVSE 383

Query: 234 AER 242
            ER
Sbjct: 384 EER 386


>UniRef50_Q0U4R2 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 654

 Score =  110 bits (265), Expect = 4e-23
 Identities = 72/198 (36%), Positives = 107/198 (54%), Gaps = 3/198 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +DIA   FET K   TI+DAPGH+DFI NMI+G+SQAD  VL++ A T  FEAG+   GQ
Sbjct: 309 VDIATNYFETEKTRFTILDAPGHKDFIPNMISGSSQADFPVLVIDASTNSFEAGL--KGQ 366

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+EH L+A ++G++ +IV VNKMD+++      D    R K   T     +    + F+P
Sbjct: 367 TKEHILIARSMGMQHIIVAVNKMDTVSWSKPRFDDISKRMKVFLT--EASFPEKRITFIP 424

Query: 616 ISGWHGDNMLE--PSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPA 789
           ++G  G+N+++   +    W+             G+ L+EAL+ I  P R +     F  
Sbjct: 425 LAGLTGENVVKRVANPAADWY------------TGETLLEALERIELPERNMQKALRFSV 472

Query: 790 RRIXNSVVXVPCP-SGRI 840
             +    +  P   SGRI
Sbjct: 473 SDVFRGDMRSPLSISGRI 490



 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 29/59 (49%), Positives = 41/59 (69%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 242
           N VV+GHVD GKST  G L+Y    +D+R+++K  KEA+ +GK SF  AW++D+   ER
Sbjct: 245 NFVVVGHVDHGKSTLMGRLLYDLKVVDQRSLDKLRKEAETIGKSSFALAWIMDETSEER 303


>UniRef50_O74774 Cluster: Elongation factor 1 alpha related protein;
           n=1; Schizosaccharomyces pombe|Rep: Elongation factor 1
           alpha related protein - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 592

 Score =  110 bits (264), Expect = 5e-23
 Identities = 67/177 (37%), Positives = 94/177 (53%), Gaps = 4/177 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+A   FE+ K    I DAPGHRDFI  MI G S AD AVL+V +    FE G  +NGQ
Sbjct: 243 MDVASTTFESDKKIYEIGDAPGHRDFISGMIAGASSADFAVLVVDSSQNNFERGFLENGQ 302

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKY--PHTSRRLGYNPAAVAF 609
           TREHA L   LG+ +++V VNK+D ++    S D  +  +        + +G+  + V F
Sbjct: 303 TREHAYLLRALGISEIVVSVNKLDLMSW---SEDRFQEIKNIVSDFLIKMVGFKTSNVHF 359

Query: 610 VPISGWHGDNML--EPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP 774
           VPIS   G N++  + S    W+K            G  L+ ALD ++PP +P   P
Sbjct: 360 VPISAISGTNLIQKDSSDLYKWYK------------GPTLLSALDQLVPPEKPYRKP 404



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 31/63 (49%), Positives = 44/63 (69%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  +++VV GHVDSGKST  G ++++ G I+ R+++K   EA   GKGSF YAW+LD  +
Sbjct: 175 KPVVHLVVTGHVDSGKSTMLGRIMFELGEINSRSMQKLHNEAANSGKGSFSYAWLLDTTE 234

Query: 234 AER 242
            ER
Sbjct: 235 EER 237


>UniRef50_Q6JIY6 Cluster: Translation elongation factor 1 alpha;
           n=3; Microsporidia|Rep: Translation elongation factor 1
           alpha - Antonospora locustae (Nosema locustae)
          Length = 478

 Score =  109 bits (263), Expect = 7e-23
 Identities = 63/180 (35%), Positives = 94/180 (52%), Gaps = 3/180 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI L +F+  K+   IID PGH+DFIKN +TG +QAD AV +V A   +F A  S    
Sbjct: 73  IDITLKEFKLKKFNANIIDCPGHKDFIKNTVTGAAQADVAVALVPA--SDFAAATSPKAT 130

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
            ++H +++  +G+K+LI+ VNKMD              +++    S+RL  +   +  +P
Sbjct: 131 LKDHIMISGVMGIKRLIICVNKMDEFPPEKQKEKFEWIKKEMLFISQRLHPDKDPI-IIP 189

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGK---CLIEALDAILPPARPLTSPCVFP 786
           ISG  G N+ +   K  WF+GWQ +       G+    L  AL+    P RP+  P   P
Sbjct: 190 ISGLKGINIADHGEKFEWFEGWQKKDANNNLIGEKVFTLEGALNYCDLPERPIGKPLRMP 249



 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 33/68 (48%), Positives = 46/68 (67%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           M  +K ++N+ +IGHVDSGKSTT G+L Y+ G  D+R + K + EA   GKG+F YA+  
Sbjct: 1   MEGKKPNLNVCIIGHVDSGKSTTMGNLAYQLGVFDQRQLTKLKAEADSHGKGTFAYAYFF 60

Query: 222 DKLKAERE 245
           D   AER+
Sbjct: 61  DNTAAERK 68


>UniRef50_O13354 Cluster: Eukaryotic peptide chain release factor
           GTP-binding subunit; n=31; cellular organisms|Rep:
           Eukaryotic peptide chain release factor GTP-binding
           subunit - Candida albicans (Yeast)
          Length = 715

 Score =  109 bits (263), Expect = 7e-23
 Identities = 56/143 (39%), Positives = 81/143 (56%), Gaps = 2/143 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I++    FET K   TI+DAPGH+ ++  MI G SQAD  +L+++A  GE+E G  K GQ
Sbjct: 358 IEVGKAYFETDKRRYTILDAPGHKMYVSEMIGGASQADVGILVISARKGEYETGFEKGGQ 417

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREHALLA T GV ++IV VNKMD           ++   K     + +GY    + ++P
Sbjct: 418 TREHALLAKTQGVNKIIVVVNKMDDSTVGWSKERYQECTTKLGAFLKGIGYAKDDIIYMP 477

Query: 616 ISGWHGDNMLE--PSTKMPWFKG 678
           +SG+ G  + +       PW+ G
Sbjct: 478 VSGYTGAGLKDRVDPKDCPWYDG 500



 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 30/63 (47%), Positives = 48/63 (76%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K H++I+ +GHVD+GKST  G+++Y  G +DKRT+EK+E+EA++ G+  +  +WV+D  K
Sbjct: 290 KDHVSIIFMGHVDAGKSTMGGNILYLTGSVDKRTVEKYEREAKDAGRQGWYLSWVMDTNK 349

Query: 234 AER 242
            ER
Sbjct: 350 EER 352


>UniRef50_A2FN77 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Trichomonas vaginalis G3|Rep:
           Elongation factor Tu C-terminal domain containing
           protein - Trichomonas vaginalis G3
          Length = 607

 Score =  109 bits (262), Expect = 9e-23
 Identities = 61/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+AL  FET    +T++DAPGHRDF+ NMI G SQAD A+L+V       E      GQ
Sbjct: 256 IDVALNNFETEDRKITVLDAPGHRDFVPNMIAGASQADSAILVVDVSNPNIE-----RGQ 310

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNH-HTVSPDLRKSRRKYPHTSRRLGYNPAAVAFV 612
             EH LL  +LGVK LIV +NKMDSL +  +   D+  +  ++    +R+ +  +AV F+
Sbjct: 311 AGEHILLCRSLGVKHLIVAINKMDSLEYMQSAYEDVCNTLTEH---LKRISW--SAVHFI 365

Query: 613 PISGWHGDNMLEPSTKMPWFKG 678
           P        +L P  KMPW+KG
Sbjct: 366 PTVATDKSVLLNPKEKMPWYKG 387



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 22/63 (34%), Positives = 43/63 (68%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K H+N+V++GHVD+GKST  GH++     ++K+ ++K  ++++  G G    AW++ + +
Sbjct: 188 KKHVNLVIVGHVDAGKSTLIGHVLLLSNFVEKQRMDKIMEDSKATGHGQDYLAWIMAEDE 247

Query: 234 AER 242
           +ER
Sbjct: 248 SER 250


>UniRef50_Q759Q2 Cluster: ADR221Cp; n=3; Saccharomycetales|Rep:
           ADR221Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 614

 Score =  109 bits (262), Expect = 9e-23
 Identities = 54/143 (37%), Positives = 84/143 (58%), Gaps = 2/143 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +DI   +FET+K   T+IDAPGHRDF+ N +TG + AD A++ +   T  FE+G + +GQ
Sbjct: 243 VDICTSEFETAKSTFTVIDAPGHRDFVPNAVTGVNLADVAIVTIDCATDAFESGFNLDGQ 302

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TREH +LA +LGVK +I+ +NKMD++  H      +  R +       +G+     ++VP
Sbjct: 303 TREHIILARSLGVKHIILAMNKMDTVEWH--EGRFKAIRLELLSFLEDIGFKEPQTSWVP 360

Query: 616 ISGWHGDNMLEPS--TKMPWFKG 678
            SG  G+ + +        W+KG
Sbjct: 361 CSGLTGEGVYQKGYPPSQNWYKG 383



 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 30/65 (46%), Positives = 46/65 (70%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 227
           ++K H++ VV+GHVD+GKST  G L+Y  G +D + I + ++E++  GKGSF  AWV+D+
Sbjct: 173 EKKPHMSFVVLGHVDAGKSTLMGRLLYDVGAVDTKLIRQLKRESELAGKGSFHLAWVMDQ 232

Query: 228 LKAER 242
              ER
Sbjct: 233 TNEER 237


>UniRef50_Q5KFJ4 Cluster: Translation release factor, putative; n=3;
           Eukaryota|Rep: Translation release factor, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 757

 Score =  109 bits (261), Expect = 1e-22
 Identities = 65/188 (34%), Positives = 99/188 (52%), Gaps = 3/188 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FE+ K   TI+DAPGH+ ++ +MI+G +QAD A+L+++A  GEFE G  + GQ
Sbjct: 381 VEVGRAYFESEKRRYTILDAPGHKTYVPSMISGAAQADVALLVLSARKGEFETGFEREGQ 440

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           TREHA+L    G+ +LIV VNKMD            +   K     + +G+NP   + F+
Sbjct: 441 TREHAMLIKNNGINKLIVVVNKMDDTTVQWDKGRYDEITTKITPFLKAVGFNPKTDITFI 500

Query: 613 PISGWHGDNMLEPSTK--MPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFP 786
           P+S   G+NM +   K   PW   W         DG  L+E LD +    R + +P + P
Sbjct: 501 PVSAQIGENMKDRVDKKIAPW---W---------DGPSLLEHLDNMEIMDRNINAPFMLP 548

Query: 787 ARRIXNSV 810
                N +
Sbjct: 549 ISEKYNEL 556



 Score = 76.6 bits (180), Expect = 8e-13
 Identities = 32/63 (50%), Positives = 46/63 (73%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K+H+NI+  GHVD+GKST  G L+Y  G +DKRT+EK+E+EA+  G+ ++  +W LD  K
Sbjct: 313 KSHLNIIFTGHVDAGKSTMGGQLLYLTGAVDKRTMEKYEQEAKAAGRETWYLSWALDSGK 372

Query: 234 AER 242
            ER
Sbjct: 373 EER 375


>UniRef50_Q9NCN6 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=1; Sterkiella histriomuscorum|Rep: Eukaryotic
           release factor 3 GTPase subunit - Oxytricha trifallax
           (Sterkiella histriomuscorum)
          Length = 937

 Score =  108 bits (259), Expect = 2e-22
 Identities = 59/151 (39%), Positives = 87/151 (57%), Gaps = 10/151 (6%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++     ET K   TI DAPGH++++ NMI G + AD   L+++A  GEFE+G    GQ
Sbjct: 485 VEVGRANIETPKKRWTIFDAPGHKNYVPNMIMGAALADFGALVISAKKGEFESGFEMEGQ 544

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRL-------GYNP 594
           TREH  LA +LG+ +++V VNKMD        P ++ S+ +Y      L       GY+P
Sbjct: 545 TREHIQLAKSLGISKIVVAVNKMD-------EPSVKWSKDRYTEIINGLKPFMQGCGYDP 597

Query: 595 AA-VAFVPISGWHGDNMLEPSTK--MPWFKG 678
              + FVPISG +GDN+ +P  K    W++G
Sbjct: 598 EKDIVFVPISGLNGDNLKDPLNKAVCNWYQG 628



 Score = 64.9 bits (151), Expect = 3e-09
 Identities = 30/77 (38%), Positives = 53/77 (68%)
 Frame = +3

Query: 12  TQFVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMG 191
           TQ V  +   + + +   ++V IGHVD+GKST +G+L+Y  G +D+RTI+K+++EA+E  
Sbjct: 403 TQVVDEEVIDVDETRQPASLVFIGHVDAGKSTISGNLMYLMGAVDQRTIQKYKEEAKEKN 462

Query: 192 KGSFKYAWVLDKLKAER 242
           + S+  A+V+D  + E+
Sbjct: 463 RESWWLAYVMDVSEEEK 479


>UniRef50_Q9NCN5 Cluster: Eukaryotic release factor 3 GTPase
           subunit; n=2; Euplotes|Rep: Eukaryotic release factor 3
           GTPase subunit - Euplotes aediculatus
          Length = 805

 Score =  108 bits (259), Expect = 2e-22
 Identities = 65/178 (36%), Positives = 91/178 (51%), Gaps = 1/178 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++     ET     TI DAPGH++++ +MI G + AD A L+++A  GEFEAG  ++GQ
Sbjct: 375 VEVGRATMETPTKRYTIFDAPGHKNYVPDMIMGAAMADVAALVISARKGEFEAGFERDGQ 434

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRK-SRRKYPHTSRRLGYNPAAVAFV 612
           TREHA LA +LGV +L+V VNKMD                   P    + GY    + F+
Sbjct: 435 TREHAQLARSLGVSKLVVVVNKMDEETVQWNEARYNDIVSGVTPFLIEQCGYKREDLIFI 494

Query: 613 PISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFP 786
           PISG +G N+ + +    W++            G  LIE LD I PP R    P   P
Sbjct: 495 PISGLNGQNIEKLTPACTWYQ------------GPTLIEILDNIEPPKRNADGPLRVP 540



 Score = 60.5 bits (140), Expect = 6e-08
 Identities = 26/53 (49%), Positives = 41/53 (77%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 224
           ++V IGHVD+GKST  G+L++  G +D+RT EKF++EA+E  + S+  A+V+D
Sbjct: 311 SLVFIGHVDAGKSTICGNLMFMTGMVDERTTEKFKQEAKEKNRDSWWLAYVMD 363


>UniRef50_Q2GS47 Cluster: Putative uncharacterized protein; n=1;
            Chaetomium globosum|Rep: Putative uncharacterized protein
            - Chaetomium globosum (Soil fungus)
          Length = 840

 Score =  108 bits (259), Expect = 2e-22
 Identities = 75/201 (37%), Positives = 107/201 (53%), Gaps = 6/201 (2%)
 Frame = +1

Query: 256  IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
            +DIA  +FET     TI+DAPGH ++I NMI G SQAD A+L++ A    FE+G+   GQ
Sbjct: 499  MDIATRRFETEHTAFTILDAPGHAEYIYNMIAGASQADFAILVIDASIDAFESGL--KGQ 556

Query: 436  TREHALLAFTLGVKQLIVGVNKMDSLN-HHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFV 612
            TREH+LL  ++GV ++IV VNK+D++        +++     +  T+    +    +AFV
Sbjct: 557  TREHSLLIRSMGVSRIIVAVNKLDTVAWSQERFSEIKDQMSGFLSTA---NFQHKNMAFV 613

Query: 613  PISGWHGDNML--EPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSP---C 777
            P+SG +GDN++   P     W+             G  L+E L+   P AR L  P    
Sbjct: 614  PVSGLNGDNLVHRSPDPAASWY------------TGPTLVEELENSEPSARALAKPLRMT 661

Query: 778  VFPARRIXNSVVXVPCPSGRI 840
            VF   R   S V V   SGRI
Sbjct: 662  VFEVYRTMQSPVTV---SGRI 679



 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 34/65 (52%), Positives = 44/65 (67%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 227
           K K   + VV+GHVD+GKST  G L+     +D+RTI+K +KEA+  GKGSF  AWVLD+
Sbjct: 429 KPKKSASFVVVGHVDAGKSTMMGRLLLDLKVVDQRTIDKLQKEAKTEGKGSFGLAWVLDQ 488

Query: 228 LKAER 242
              ER
Sbjct: 489 RPEER 493


>UniRef50_Q6WZ47 Cluster: Elongation factor-1 alpha; n=3;
           Coelomata|Rep: Elongation factor-1 alpha - Anduzedoras
           oxyrhynchus
          Length = 257

 Score =  106 bits (255), Expect = 6e-22
 Identities = 45/66 (68%), Positives = 52/66 (78%)
 Frame = +1

Query: 601 VAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCV 780
           VAFVPISGWHGDNMLEPS+ M WFKGW++ERKEG A G  L+EALDAILPP+RP   P  
Sbjct: 1   VAFVPISGWHGDNMLEPSSNMGWFKGWKIERKEGNASGTTLLEALDAILPPSRPTDKPLR 60

Query: 781 FPARRI 798
            P + +
Sbjct: 61  LPLQDV 66


>UniRef50_Q9LM39 Cluster: T10O22.4; n=7; Magnoliophyta|Rep: T10O22.4
           - Arabidopsis thaliana (Mouse-ear cress)
          Length = 615

 Score =  105 bits (252), Expect = 1e-21
 Identities = 62/146 (42%), Positives = 81/146 (55%), Gaps = 5/146 (3%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT--GEFEAGISKN 429
           +++    FET     TI+DAPGH+ ++ NMI+G SQAD  VL+    T  GEFE G  + 
Sbjct: 203 VEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGVLVSQLITRKGEFETGYERG 262

Query: 430 GQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VA 606
           GQTREH  LA TLGV +LIV VNKMD    +       +  +K     +  GYN    V 
Sbjct: 263 GQTREHVQLAKTLGVSKLIVVVNKMDDPTVNWSKERYDEIEQKMVPFLKASGYNTKKDVV 322

Query: 607 FVPISGWHGDNMLEPSTK--MPWFKG 678
           F+PISG  G NM +   +   PW+ G
Sbjct: 323 FLPISGLMGKNMDQRMGQEICPWWSG 348



 Score = 69.7 bits (163), Expect = 9e-11
 Identities = 31/76 (40%), Positives = 52/76 (68%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           +K H+N+V IGHVD+GKST  G +++  G +D R I+K+EKEA++  + S+  A+++D  
Sbjct: 118 KKRHLNVVFIGHVDAGKSTIGGQILFLSGQVDDRQIQKYEKEAKDKSRESWYMAYIMDTN 177

Query: 231 KAEREXVSNRYCSLEV 278
           + ER  V + + S+ V
Sbjct: 178 EEERLKVLHVFWSMFV 193


>UniRef50_Q8SS29 Cluster: TRANSLATION ELONGATION FACTOR 1 ALPHA;
           n=2; Apansporoblastina|Rep: TRANSLATION ELONGATION
           FACTOR 1 ALPHA - Encephalitozoon cuniculi
          Length = 505

 Score =  105 bits (252), Expect = 1e-21
 Identities = 62/181 (34%), Positives = 92/181 (50%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I   L    T K+ + I+D PGH+DF+KNM+TG SQAD AV+IV A    FE+ +   G 
Sbjct: 112 ITTTLVNLPTEKFNINILDCPGHKDFVKNMVTGASQADVAVVIVPA--SGFESCVGVGGM 169

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
            + H +++  LG ++LIV VNKMD +  +       +   +     +R  +       +P
Sbjct: 170 LKTHIMISGILGCEKLIVCVNKMDEIPENKRMEKFNEVSAEMLRIVKR-SHKDKNPIIIP 228

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           IS + G N+ +   K  WFKGW  + KEG +    L EAL+    P R    P   P  +
Sbjct: 229 ISAFKGINLTKKGEKFEWFKGW--KEKEGSSVIYTLEEALNYQDVPERHNDKPLRMPITK 286

Query: 796 I 798
           +
Sbjct: 287 V 287



 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 34/64 (53%), Positives = 43/64 (67%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  +N   IGHVDSGKSTT G L Y+ G +DKR +EK+EKEA    K +F  A++ DK  
Sbjct: 44  KPRLNACFIGHVDSGKSTTVGMLSYQLGAVDKREMEKYEKEAALNNKETFYLAYLTDKTD 103

Query: 234 AERE 245
           AER+
Sbjct: 104 AERK 107


>UniRef50_Q4E4V1 Cluster: Elongation factor 1-alpha (EF-1-alpha),
           putative; n=3; Trypanosoma|Rep: Elongation factor
           1-alpha (EF-1-alpha), putative - Trypanosoma cruzi
          Length = 664

 Score =  105 bits (251), Expect = 2e-21
 Identities = 56/143 (39%), Positives = 85/143 (59%), Gaps = 2/143 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID   + FET    + I+DAPGH+D++ NMI+  +QAD A+L+V A T EFE G++    
Sbjct: 313 IDAGSYCFETEHRRINILDAPGHKDYVLNMISSATQADAALLVVTAATSEFEVGLAHG-- 370

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGY-NPAAVAFV 612
           T+EH  +  TL V +LIV VNKMD++++     D      K+    +++ Y   A V F 
Sbjct: 371 TKEHLFILKTLSVGRLIVAVNKMDTVDYSKERYDYVVRELKF--LLKQIRYKEEAVVGFC 428

Query: 613 PISGWHGDNMLEPSTK-MPWFKG 678
           P+SG  G N+L  + +  PW++G
Sbjct: 429 PVSGMQGTNILHVNREATPWYEG 451



 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 33/63 (52%), Positives = 43/63 (68%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K     V+ GHVD+GKSTT GHL+   G + +  IEK EK A+++  GSFKYAWVLD+ +
Sbjct: 245 KRDCTFVIAGHVDAGKSTTLGHLLLLLGKVSQSEIEKNEKNARQLNSGSFKYAWVLDQSE 304

Query: 234 AER 242
            ER
Sbjct: 305 EER 307


>UniRef50_Q8WT68 Cluster: Elongation factor-1 alpha; n=3;
           Endopterygota|Rep: Elongation factor-1 alpha -
           Xiphocentron sp. UMSP000029372-Costa Rica
          Length = 366

 Score =  102 bits (245), Expect = 1e-20
 Identities = 65/165 (39%), Positives = 90/165 (54%)
 Frame = +3

Query: 255 NRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLSG*LRCAHRSCRYR*IRSWYL*ERS 434
           +R+ ++EVR+ QVL  HH  +  Q  HQEHDH +++G LR A R  R+R +R  +L ER 
Sbjct: 27  HRHRAVEVRDGQVLRDHHRRARPQGLHQEHDHGHVAGGLRRADRGRRHRRVRGGHLQERP 86

Query: 435 NP*ACLARFHPRCQTAHRRSKQNGFTEPPYSEPRFEEIKKEVSSYIKKIGLQPSCCRFRA 614
           +  A LA  H R Q A RR +Q+G              ++      ++  LQP     RA
Sbjct: 87  DARARLAGLHARRQAARRRRQQDGLDGAALQRAALRGDQEGGVVVHQEDRLQPGRRGVRA 146

Query: 615 HFWMARRQHVGAFNQNALVQGMAGGA*GRQS*RKMPH*SSRCHPA 749
           H  +ARRQH GA  Q+A+VQG+ GGA G Q   ++P      HPA
Sbjct: 147 HLGLARRQHAGAVRQDAVVQGVEGGAQGGQRRGQVPDRGVGRHPA 191


>UniRef50_Q17263 Cluster: Elongation factor 1 alpha; n=4;
           Fungi/Metazoa group|Rep: Elongation factor 1 alpha -
           Brugia pahangi (Filarial nematode worm)
          Length = 123

 Score =  101 bits (242), Expect = 2e-20
 Identities = 46/51 (90%), Positives = 47/51 (92%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK 194
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE +   K
Sbjct: 23  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKERKRWAK 73


>UniRef50_P32769 Cluster: Elongation factor 1 alpha-like protein;
           n=2; Saccharomyces cerevisiae|Rep: Elongation factor 1
           alpha-like protein - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 611

 Score =  100 bits (240), Expect = 4e-20
 Identities = 56/144 (38%), Positives = 86/144 (59%), Gaps = 3/144 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           + I    F T +   TI+DAPGHRDF+ N I G SQAD A+L V   T  FE+G   +GQ
Sbjct: 233 VSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFESGFDLDGQ 292

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+EH LLA +LG+  LI+ +NKMD+++      +  KS +  P+    +G+    + +VP
Sbjct: 293 TKEHMLLASSLGIHNLIIAMNKMDNVDWSQQRFEEIKS-KLLPYLV-DIGFFEDNINWVP 350

Query: 616 ISGWHGDNM--LEPSTKM-PWFKG 678
           ISG+ G+ +  +E + ++  W+ G
Sbjct: 351 ISGFSGEGVYKIEYTDEVRQWYNG 374



 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 28/62 (45%), Positives = 45/62 (72%)
 Frame = +3

Query: 60  HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 239
           H++ VV+GHVD+GKST  G L+Y    +++  + K ++E++ MGK SFK+AW++D+   E
Sbjct: 167 HLSFVVLGHVDAGKSTLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEE 226

Query: 240 RE 245
           RE
Sbjct: 227 RE 228


>UniRef50_Q7YZN9 Cluster: Eukaryotic release factor 3; n=2;
           Dictyostelium discoideum|Rep: Eukaryotic release factor
           3 - Dictyostelium discoideum (Slime mold)
          Length = 557

 Score =  100 bits (239), Expect = 6e-20
 Identities = 57/144 (39%), Positives = 82/144 (56%), Gaps = 3/144 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    FET+K   TI+DAPGHR ++ NMI G +QAD  +L++++  GEFEAG+ + GQ
Sbjct: 183 VEVGRAHFETTKKRYTILDAPGHRLYVPNMIIGAAQADVGILVISSKKGEFEAGV-EGGQ 241

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA-VAFV 612
           T EHA LA  +G+K L+V VNKMD            +   K     ++ G+NP     FV
Sbjct: 242 TIEHARLAKMIGIKYLVVFVNKMDEPTVKWSKARYDEITDKLTVHLKKCGWNPKKDFHFV 301

Query: 613 PISGWHGDNMLEPSTK--MPWFKG 678
           P SG+   N+L P       W+ G
Sbjct: 302 PGSGYGTLNVLAPLAPGVCDWYSG 325



 Score = 63.3 bits (147), Expect = 8e-09
 Identities = 26/63 (41%), Positives = 44/63 (69%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           + H+NIV +GHVD+GKST +G ++   G +D  T+ K+E+EA+E  +  + YA+++D  +
Sbjct: 115 REHLNIVFLGHVDAGKSTLSGSIMVLTGQVDPHTLAKYEREAKENHREGWIYAYIMDTNE 174

Query: 234 AER 242
            ER
Sbjct: 175 EER 177


>UniRef50_Q8IFW1 Cluster: Elongation factor-1 alpha; n=1; Exoneura
           angophorae|Rep: Elongation factor-1 alpha - Exoneura
           angophorae
          Length = 139

 Score = 96.3 bits (229), Expect = 9e-19
 Identities = 45/79 (56%), Positives = 57/79 (72%)
 Frame = +1

Query: 418 ISKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPA 597
           +  +G+ REHALLAFTLGVKQLIVGVNKMD  +         + +++     +++GYN A
Sbjct: 60  VDSSGRHREHALLAFTLGVKQLIVGVNKMDMTDPPYSETRFEEIKKEVSSYIKKIGYNTA 119

Query: 598 AVAFVPISGWHGDNMLEPS 654
           +VAFVPISGWHGDNMLE S
Sbjct: 120 SVAFVPISGWHGDNMLESS 138



 Score = 73.7 bits (173), Expect = 6e-12
 Identities = 51/123 (41%), Positives = 66/123 (53%)
 Frame = +3

Query: 240 REXVSNRYCSLEVRN*QVLCYHH*CSWTQRFHQEHDHRNLSG*LRCAHRSCRYR*IRSWY 419
           R    +RY  +EVR+ ++L  +H  + + RFHQEHDHR+ SG LR    S R+R      
Sbjct: 14  RARYHDRYRVVEVRDGEILRDYHRRARSSRFHQEHDHRDESGGLRRVDSSGRHR------ 67

Query: 420 L*ERSNP*ACLARFHPRCQTAHRRSKQNGFTEPPYSEPRFEEIKKEVSSYIKKIGLQPSC 599
             E +     L  F    +       +   T+PPYSE RFEEIKKEVSSYIKKIG   + 
Sbjct: 68  --EHA-----LLAFTLGVKQLIVGVNKMDMTDPPYSETRFEEIKKEVSSYIKKIGYNTAS 120

Query: 600 CRF 608
             F
Sbjct: 121 VAF 123


>UniRef50_Q19AS6 Cluster: Translation elongation factor 1 alpha;
           n=7; Fungi/Metazoa group|Rep: Translation elongation
           factor 1 alpha - Fusarium sp. CBS 100485
          Length = 61

 Score = 95.5 bits (227), Expect = 2e-18
 Identities = 42/45 (93%), Positives = 44/45 (97%)
 Frame = +3

Query: 111 TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           TGHLIY+CGGIDKRTIEKFEKEA E+GKGSFKYAWVLDKLKAERE
Sbjct: 1   TGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERE 45


>UniRef50_Q97MT1 Cluster: GTPase, sulfate adenylate transferase
           subunit 1; n=2; Clostridium|Rep: GTPase, sulfate
           adenylate transferase subunit 1 - Clostridium
           acetobutylicum
          Length = 522

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 54/141 (38%), Positives = 81/141 (57%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           IDI + +F T K    IIDAPGH++F+KNMI+G + A+ A+L+V A  G  E       Q
Sbjct: 71  IDITMIQFFTKKRDYVIIDAPGHKEFLKNMISGAASAEAAILVVDAKEGIQE-------Q 123

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           ++ H  +   LG+K++ V VNKMD +++     + R +       S     N    A++P
Sbjct: 124 SKRHGYILSLLGIKKVYVAVNKMDLVDY----SEERYNEIVTQFNSFLANLNIYPEAYIP 179

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           IS + GDN+ + S KMPW+KG
Sbjct: 180 ISAFLGDNVAKKSEKMPWYKG 200



 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 26/63 (41%), Positives = 40/63 (63%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           + ++N+V +GHVD GKST  G L+Y    +    IEK +K + E GK  F+YA++LD  +
Sbjct: 4   RENLNVVFVGHVDHGKSTLIGRLLYDTNSLPDGAIEKVKKISAEEGK-KFEYAFLLDAFE 62

Query: 234 AER 242
            E+
Sbjct: 63  EEQ 65


>UniRef50_Q8SRN3 Cluster: TRANSLATION ELONGATION FACTOR 1-ALPHA;
           n=1; Encephalitozoon cuniculi|Rep: TRANSLATION
           ELONGATION FACTOR 1-ALPHA - Encephalitozoon cuniculi
          Length = 424

 Score = 94.7 bits (225), Expect = 3e-18
 Identities = 53/140 (37%), Positives = 75/140 (53%)
 Frame = +1

Query: 259 DIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 438
           ++    FE     V I+DAPGH  F+  MI G ++AD  +L+V+A   EFEAG  K GQT
Sbjct: 80  EVGTASFELPHRRVNILDAPGHNQFVFEMINGANRADVGILVVSARINEFEAGFEKGGQT 139

Query: 439 REHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPI 618
           REH  L     V++LIV VNKMD  +         + + K     RR+   P    F+P+
Sbjct: 140 REHIFLLKAGSVQRLIVLVNKMDDPSVEWRKERFDEIKTKVGAFVRRMFPTP---VFIPV 196

Query: 619 SGWHGDNMLEPSTKMPWFKG 678
           SG+ G+ + E  +  PW+ G
Sbjct: 197 SGFTGEYIKEKGS-CPWYDG 215



 Score = 62.9 bits (146), Expect = 1e-08
 Identities = 28/64 (43%), Positives = 42/64 (65%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  INIV +GHVD+GKST  G ++ + G +D RT+EK+ + ++E  + S+  +W LD   
Sbjct: 11  KKVINIVFVGHVDAGKSTICGQILVQMGLVDPRTLEKYRQMSREQNRESWYLSWCLDTNP 70

Query: 234 AERE 245
            ERE
Sbjct: 71  EERE 74


>UniRef50_Q4FW53 Cluster: Hsp70 subfamily B suppressor 1; n=3;
           Leishmania|Rep: Hsp70 subfamily B suppressor 1 -
           Leishmania major strain Friedlin
          Length = 647

 Score = 93.9 bits (223), Expect = 5e-18
 Identities = 54/140 (38%), Positives = 76/140 (54%), Gaps = 1/140 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID   + FET    V I+DAPGH+DF+ NMI+  +QAD A+L+V A   EFE G+     
Sbjct: 293 IDSGSFCFETEHRRVHILDAPGHKDFVLNMISSATQADAALLVVTATNSEFETGLHHG-- 350

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+ H L+  TLGV  ++V VNKMD++ +     D      +      R+    A + F P
Sbjct: 351 TKSHLLVLKTLGVGSIVVAVNKMDAVAYSQERYDYVVRELQLLLKQTRIP-EEAIIGFCP 409

Query: 616 ISGWHGDNMLEPSTK-MPWF 672
           ISG  G N+ +   K  PW+
Sbjct: 410 ISGMTGVNITQRGAKETPWY 429



 Score = 68.1 bits (159), Expect = 3e-10
 Identities = 31/65 (47%), Positives = 42/65 (64%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 227
           KEK     V+ GHVD+GKSTT GHL+   G +  + +E+ EK  +   K SFKYAW+LD+
Sbjct: 223 KEKPDCTFVIAGHVDAGKSTTLGHLLLLLGRVSIQDVERNEKADRTHHKDSFKYAWLLDQ 282

Query: 228 LKAER 242
            + ER
Sbjct: 283 CEEER 287


>UniRef50_A0E926 Cluster: Chromosome undetermined scaffold_84, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_84,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 756

 Score = 93.9 bits (223), Expect = 5e-18
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 2/137 (1%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           +F T +    + DAPGH++++ NMI G  QAD A LIV+A TGEFE+G  K GQT+EHAL
Sbjct: 400 QFVTKQKRFILADAPGHKNYVPNMIMGACQADLAGLIVSAKTGEFESGFEKGGQTQEHAL 459

Query: 454 LAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHG 633
           LA +LGV  +I+ V KMD+++ +    +L  S+       ++  ++   V  +PI    G
Sbjct: 460 LAKSLGVDHIIIIVTKMDTIDWNQDRFNL-ISQNIQEFVLKQCKFDNIYV--IPIDALSG 516

Query: 634 DNMLE--PSTKMPWFKG 678
            N+      +K  W+KG
Sbjct: 517 SNIKSRVDESKCNWYKG 533



 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 24/61 (39%), Positives = 43/61 (70%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 242
           +N+V IGHVD+GKST  G L+ + G + +  I+K+E+EA +  + S+  A+V+D+ + E+
Sbjct: 329 VNLVFIGHVDAGKSTLCGRLLLELGEVSEADIKKYEQEAVQNNRDSWWLAYVMDQNEEEK 388

Query: 243 E 245
           +
Sbjct: 389 Q 389


>UniRef50_Q0YG57 Cluster: Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit; n=2; Geobacter|Rep:
           Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit - Geobacter sp.
           FRC-32
          Length = 619

 Score = 93.5 bits (222), Expect = 6e-18
 Identities = 65/181 (35%), Positives = 90/181 (49%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID A   F     +  IIDAPGH++F+KNMI+G ++A+ AVLI+ A  G  E       Q
Sbjct: 100 IDTARTFFNWGNRHYIIIDAPGHKEFLKNMISGAARAEAAVLIIDAAEGVAE-------Q 152

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           ++ H  +   LG++Q+ V VNKMD +NH            +Y    + LG  P    FVP
Sbjct: 153 SKRHGYMLSLLGIRQIAVVVNKMDLVNHD--QKVFEAIVTEYSAFLKELGVTPR--QFVP 208

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
            S  +GDN++  S  MPW+ G  V    G+ +     E     LP   P+     F ARR
Sbjct: 209 ASARNGDNVVTGSDAMPWYDGPTVLESLGRFEKLPSGEE----LPLRFPVQDVYKFDARR 264

Query: 796 I 798
           I
Sbjct: 265 I 265



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 20/61 (32%), Positives = 33/61 (54%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 242
           + +V +GHVD GKST  G +      +    +EK     ++ GK +F+YA++ D    E+
Sbjct: 36  LQVVFVGHVDHGKSTLLGRIYADTDSLPVGQLEKVRAICEQQGK-TFEYAFLFDAFLEEQ 94

Query: 243 E 245
           E
Sbjct: 95  E 95


>UniRef50_UPI000150A7E9 Cluster: Elongation factor Tu C-terminal
           domain containing protein; n=2; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 646

 Score = 92.7 bits (220), Expect = 1e-17
 Identities = 52/136 (38%), Positives = 81/136 (59%), Gaps = 2/136 (1%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 456
           F+ +     ++DAPGH++++ NMI G  QAD A LI++A  GEFEAG  + GQT+EHA L
Sbjct: 294 FQLANKRFVLLDAPGHKNYVPNMIAGACQADVAALIISARQGEFEAGF-EGGQTQEHAHL 352

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGD 636
           A  LGV+ +I  V+KMD +N      D      + P    ++G    ++ +VPI+G+  +
Sbjct: 353 AKALGVQHMICVVSKMDEVNWDKKRYDHIHDSVE-PFLRNQVGIQ--SIEWVPINGFLNE 409

Query: 637 NMLE--PSTKMPWFKG 678
           N+    P+ +  W+KG
Sbjct: 410 NIDTPIPTERCEWYKG 425



 Score = 68.9 bits (161), Expect = 2e-10
 Identities = 30/68 (44%), Positives = 47/68 (69%)
 Frame = +3

Query: 39  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 218
           K+ +E+  +NIV IGHVD+GKST +G ++  CG +D+  I KFE EA+E  + S+  A++
Sbjct: 214 KVDRERDSVNIVFIGHVDAGKSTLSGRILKNCGEVDETEIRKFELEAKEKNRESWVLAYI 273

Query: 219 LDKLKAER 242
           +D  + ER
Sbjct: 274 MDINEEER 281


>UniRef50_Q6CFF3 Cluster: Similar to tr|Q9WTY5 Mus musculus ERFS;
           n=1; Yarrowia lipolytica|Rep: Similar to tr|Q9WTY5 Mus
           musculus ERFS - Yarrowia lipolytica (Candida lipolytica)
          Length = 518

 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 51/139 (36%), Positives = 81/139 (58%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I +  + +E+ +Y+  I+DAPGH +F+ NMI G SQAD A++++ +    FE G   +GQ
Sbjct: 144 ISVREFSYESREYF--ILDAPGHYNFVPNMIAGASQADVAIVVLDSLADAFERGFFADGQ 201

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+EHALL   +GV  +I+ VNKMD L       D  +   +      ++GY+   V FVP
Sbjct: 202 TKEHALLCRAMGVNHVIIAVNKMDQLKFDQTRFD--EISDQMGLFLSKIGYSD--VQFVP 257

Query: 616 ISGWHGDNMLEPSTKMPWF 672
            SG+ G N+++    + W+
Sbjct: 258 CSGFTGANIVK-KQDISWY 275



 Score = 70.1 bits (164), Expect = 7e-11
 Identities = 29/61 (47%), Positives = 40/61 (65%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 242
           +N V +GHVD+GKST  G L++  G +    +EK  K A E+GK SF YAW++D+   ER
Sbjct: 77  LNAVAVGHVDAGKSTLLGRLLHDTGVVSSHQVEKLAKSASEIGKKSFSYAWLMDQTDEER 136

Query: 243 E 245
           E
Sbjct: 137 E 137


>UniRef50_A6GJE6 Cluster: Sulfate adenylyltransferase, large
           subunit; n=6; Bacteria|Rep: Sulfate adenylyltransferase,
           large subunit - Plesiocystis pacifica SIR-1
          Length = 653

 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 58/181 (32%), Positives = 94/181 (51%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T K    I D PGH  + +NM TG S AD A++++ A  G  +       Q
Sbjct: 116 IDVAYRYFATKKRKFIIADTPGHVQYTRNMATGASTADAAIILIDARLGVLQ-------Q 168

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           +R HA +A  +G+  L+V VNKMD ++    +   +    ++   + +LG++   V F P
Sbjct: 169 SRRHATIANLIGIPHLLVAVNKMDLVDFDQGA--YQAIVDEFRAFTAKLGFD--KVEFFP 224

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
           +S   GDN+++ ST+ PWF   +    +GK  GK L+E L+ +  P        +FP + 
Sbjct: 225 VSALEGDNVVQASTRTPWFA--ESGGADGKG-GKPLLEHLETMPVPTTGDEDRLIFPVQL 281

Query: 796 I 798
           +
Sbjct: 282 V 282



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 24/66 (36%), Positives = 36/66 (54%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 227
           + ++ +  V IG VD GKST  G L+Y+ GG+ +  +        E G+ S  +A + D 
Sbjct: 47  ERRSLLRFVTIGSVDDGKSTLIGRLLYETGGVFEDQLAAVTSTDGE-GEASINFANLTDG 105

Query: 228 LKAERE 245
           L AERE
Sbjct: 106 LVAERE 111


>UniRef50_A4XJZ8 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Caldicellulosiruptor saccharolyticus DSM
           8903|Rep: Sulfate adenylyltransferase, large subunit -
           Caldicellulosiruptor saccharolyticus (strain ATCC 43494
           / DSM 8903)
          Length = 564

 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 50/141 (35%), Positives = 79/141 (56%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID    KF T K    IIDAPGH++F+KNM++G + A+ A+L++ A  G  E       Q
Sbjct: 71  IDTTQIKFSTPKRDYLIIDAPGHKEFLKNMVSGAANAEAALLVIDAAEGVQE-------Q 123

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           ++ HA +   LG++++ V VNKMD +       + +    KY  ++     N     ++P
Sbjct: 124 SKRHAYILSLLGIQKVYVIVNKMDMIEF----SEKKFKEIKYEISTFLSKLNVYPQKYIP 179

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           +SG+ G+N+   S KMPW+KG
Sbjct: 180 VSGFLGENIARKSDKMPWYKG 200



 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 25/61 (40%), Positives = 42/61 (68%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 242
           + IVV+GHVD GKST  G L+Y    + +  IE+ ++ ++E G+  F+YA++LD L+ E+
Sbjct: 7   LKIVVVGHVDHGKSTIIGRLLYDTKSVPEAAIERVKRISKEKGR-PFEYAYLLDALEEEQ 65

Query: 243 E 245
           +
Sbjct: 66  K 66


>UniRef50_Q24TA2 Cluster: Adenylylsulfate kinase/sulfate
           adenylyltransferase subunit 1; n=5; Bacteria|Rep:
           Adenylylsulfate kinase/sulfate adenylyltransferase
           subunit 1 - Desulfitobacterium hafniense (strain Y51)
          Length = 614

 Score = 90.6 bits (215), Expect = 5e-17
 Identities = 52/141 (36%), Positives = 84/141 (59%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID A   F+T K    IIDAPGH +F+KNM+TG S+A+ A+L++ A     + GI +N  
Sbjct: 87  IDTARSFFKTGKRDYIIIDAPGHIEFLKNMVTGASRAEAALLVIDA-----KEGIREN-- 139

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           ++ H  +A  LG++Q++V VNKMD ++    +      RR++     +L   P  V F+P
Sbjct: 140 SKRHGHIAAMLGIRQVVVLVNKMDLVDFDRQT--FETIRREFGEFLHKLNIQP--VNFIP 195

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           +S ++GDN+   S +  W++G
Sbjct: 196 LSAFNGDNIAVRSQRTAWYEG 216



 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 23/63 (36%), Positives = 40/63 (63%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           +  +NIV++GHVD GKST  G L+   G + +  +E  ++  ++  +  F+YA++LD LK
Sbjct: 20  REQMNIVIVGHVDHGKSTVIGRLLADTGSLPEGKLEAVQEYCRKNAR-PFEYAFLLDALK 78

Query: 234 AER 242
            E+
Sbjct: 79  DEQ 81


>UniRef50_Q39DS0 Cluster: Sulfate adenylyltransferase, large
           subunit; n=29; Burkholderiaceae|Rep: Sulfate
           adenylyltransferase, large subunit - Burkholderia sp.
           (strain 383) (Burkholderia cepacia (strain ATCC 17760/
           NCIB 9086 / R18194))
          Length = 438

 Score = 90.2 bits (214), Expect = 6e-17
 Identities = 48/142 (33%), Positives = 78/142 (54%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK-NG 432
           ID+A   F T+K    I D PGH  + +NM+TG S A  A++++ A     E G++    
Sbjct: 79  IDVAYRYFATAKRKFIIADTPGHEQYTRNMVTGASTAHAAIILIDATRVTIENGVADLLP 138

Query: 433 QTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFV 612
           QT+ H+ +   L ++ +IV +NKMD +++        + R  Y   +++LG     V FV
Sbjct: 139 QTKRHSAIVKLLALQHVIVAINKMDLVDYSEAR--FNEIRDAYVTLAKQLGLTD--VRFV 194

Query: 613 PISGWHGDNMLEPSTKMPWFKG 678
           P+S   GDN++  S +MPW+ G
Sbjct: 195 PVSALKGDNIVGASERMPWYAG 216


>UniRef50_A6TTV2 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Alkaliphilus metalliredigens QYMF|Rep:
           Sulfate adenylyltransferase, large subunit -
           Alkaliphilus metalliredigens QYMF
          Length = 615

 Score = 89.8 bits (213), Expect = 8e-17
 Identities = 52/147 (35%), Positives = 85/147 (57%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID A   F+T +    IIDAPGH +F+KNM+TG ++A+ A+L++ A     + G+ +N  
Sbjct: 85  IDSARVFFKTQERKYIIIDAPGHIEFLKNMVTGAARAEVALLVIDA-----KEGVKEN-- 137

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           ++ H  L   LG+KQ++V +NKMD +++        +   +Y      +  +  A +F+P
Sbjct: 138 SKRHGYLLSMLGIKQVVVLINKMDLVDYS--KERYEEILAEYKAFLSEI--DVEAESFIP 193

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERK 696
           ISG+ G+N+   S KMPW+ G  V  K
Sbjct: 194 ISGFKGENVASGSDKMPWYSGMTVLEK 220



 Score = 53.6 bits (123), Expect = 6e-06
 Identities = 24/64 (37%), Positives = 44/64 (68%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 230
           +++++NIV++GHVD GKST  G L+   G + +  +E+ ++  ++  K  F+YA++LD L
Sbjct: 17  QQSNMNIVIVGHVDHGKSTIIGRLLADTGSLPEGKLEQVKETCRKNAK-PFEYAFLLDAL 75

Query: 231 KAER 242
           K E+
Sbjct: 76  KDEQ 79


>UniRef50_Q89UE2 Cluster: NodQ bifunctional enzyme; n=12;
           Rhizobiales|Rep: NodQ bifunctional enzyme -
           Bradyrhizobium japonicum
          Length = 638

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 64/170 (37%), Positives = 88/170 (51%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID    +F T+   + +IDAPGH +F++NMITG SQAD AVLI+ A  G  +       Q
Sbjct: 85  IDTTQIRFRTNSRDIVLIDAPGHAEFLRNMITGASQADGAVLIIDALEGVRD-------Q 137

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR H  L   LGVKQ+ + VNKMD ++    +   +    +       LG  P AV  +P
Sbjct: 138 TRRHGYLLHLLGVKQVAIVVNKMDRVDFS--ADRFQAISDEISAHLNGLGVTPTAV--IP 193

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPL 765
           IS   GD +   + ++ W+K            G  ++EALD  L PARPL
Sbjct: 194 ISARDGDGVATRTDRIGWYK------------GPTVVEALDQ-LEPARPL 230



 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 22/67 (32%), Positives = 40/67 (59%)
 Frame = +3

Query: 45  GKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD 224
           G  +  + IV++GHVD GKST  G L+++ G +    +E  +  +   G   F+++++LD
Sbjct: 15  GTTRPQVRIVIVGHVDHGKSTLVGRLLHETGSLPDGKLEMLKAVSARRGM-PFEWSFLLD 73

Query: 225 KLKAERE 245
            L+ ER+
Sbjct: 74  ALQTERD 80


>UniRef50_Q83JX8 Cluster: Sulfate adenylyltransferase subunit 1;
           n=26; Bacteria|Rep: Sulfate adenylyltransferase subunit
           1 - Shigella flexneri
          Length = 475

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 49/141 (34%), Positives = 73/141 (51%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T K    I D PGH  + +NM TG S  + A+L++ A  G  +       Q
Sbjct: 95  IDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCELAILLIDARKGVLD-------Q 147

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR H+ ++  LG+K L+V +NKMD +++        + R  Y   + +L  N   + FVP
Sbjct: 148 TRRHSFISTLLGIKHLVVAINKMDLVDYS--EETFTRIREDYLTFAGQLPGN-LDIRFVP 204

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           +S   GDN+   S  MPW+ G
Sbjct: 205 LSALEGDNVASQSESMPWYSG 225



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 7/85 (8%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFK--YAWVL 221
           + K+ +  +  G VD GKST  G L++    I +  +     +++  G    K   A ++
Sbjct: 23  QHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLV 82

Query: 222 DKLKAERE-----XVSNRYCSLEVR 281
           D L+AERE      V+ RY S E R
Sbjct: 83  DGLQAEREQGITIDVAYRYFSTEKR 107


>UniRef50_Q74CF6 Cluster: Elongation factor Tu GTP binding domain
           protein; n=1; Geobacter sulfurreducens|Rep: Elongation
           factor Tu GTP binding domain protein - Geobacter
           sulfurreducens
          Length = 516

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 65/188 (34%), Positives = 93/188 (49%), Gaps = 2/188 (1%)
 Frame = +1

Query: 241 VXRYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 420
           V    ID A   F TS+    IIDAPGH+ F+KNMITG + AD A+L+V    G  E   
Sbjct: 66  VQNITIDTASSFFSTSRRRYVIIDAPGHKQFLKNMITGAASADAAILLVDGTEGVRE--- 122

Query: 421 SKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVS-PDLRKSRRKYPHTSRRLGYNPA 597
               QT+ HA +   LG++Q++V VNK+D +++      ++    R + H+   L   PA
Sbjct: 123 ----QTKRHAHVLSLLGIRQVVVAVNKLDMIDYDRQRFQEVENDIRAFLHS---LHIVPA 175

Query: 598 AVAFVPISGWHGDNMLEPSTKMPWFKGWQV-ERKEGKADGKCLIEALDAILPPARPLTSP 774
            V  +PIS   G+NM       PW+ G  + E  +   D +      DA LP   P+   
Sbjct: 176 HV--IPISAREGENMAGRQGHTPWYAGPTILEALDAFGDVRG-----DATLPLRLPVQDV 228

Query: 775 CVFPARRI 798
             +  RRI
Sbjct: 229 YTWDGRRI 236



 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 24/67 (35%), Positives = 40/67 (59%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           M + +T + IV++GHVD GKST  G L Y  G I +   ++     +  G+  F++A+++
Sbjct: 1   MSQSET-LKIVIVGHVDHGKSTLIGRLFYDTGSIPEARRQEIAATCKAQGR-PFEFAYLM 58

Query: 222 DKLKAER 242
           D L+ ER
Sbjct: 59  DALEEER 65


>UniRef50_Q9L9U8 Cluster: Putative ATP sulfurylase large subunit;
           n=2; Proteobacteria|Rep: Putative ATP sulfurylase large
           subunit - Chromatium vinosum (Allochromatium vinosum)
          Length = 434

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 50/141 (35%), Positives = 74/141 (52%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T      I DAPGH  + +NM+T  S A  A+++V A  G          Q
Sbjct: 80  IDVAYRYFSTGTRKYIIADAPGHEQYTRNMVTAASTAHLAIILVDARRG-------VQTQ 132

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR H+ LA  +G+  L+V VNKMD +++        + R +Y   + RLG     V F+P
Sbjct: 133 TRRHSYLAHLVGLPHLVVAVNKMDLVDYDQAV--FERIRAEYLDFAARLGIED--VRFIP 188

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           +S  HGDN++E   ++ W+ G
Sbjct: 189 LSALHGDNVVERGERLDWYDG 209



 Score = 37.9 bits (84), Expect = 0.34
 Identities = 20/61 (32%), Positives = 28/61 (45%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 242
           +  +  G VD GKST  G L+Y    I   T+      +Q  G      + + D L+AER
Sbjct: 15  LRFLTCGSVDDGKSTLIGRLLYDTKAILADTLHAIAATSQRRGLSELDLSLLTDGLQAER 74

Query: 243 E 245
           E
Sbjct: 75  E 75


>UniRef50_Q22GX7 Cluster: Elongation factor Tu C-terminal domain
           containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu C-terminal domain
           containing protein - Tetrahymena thermophila SB210
          Length = 432

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 49/135 (36%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 456
           FE + +   I+D  GH++F+KN+I+G S+A   VLIVAA   E +    +  Q ++  +L
Sbjct: 80  FEMNNHNYEIVDIIGHKNFVKNIISGQSKAH-VVLIVAALQQERDEYDFQFEQIKQQLIL 138

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSR-RKYPHTSRRLGYNPAAVAFVPISGWHG 633
           A +LGVKQ+IV +NK++ +N       L K++   Y H    + +NP ++ ++P+SG  G
Sbjct: 139 AQSLGVKQIIVALNKIEIVNFSENEFTLMKNQIDNYLH---EIKFNPESIFYIPVSGVKG 195

Query: 634 DNMLEPSTKMPWFKG 678
           DN++E S  + W++G
Sbjct: 196 DNLVEKSENILWYEG 210



 Score = 44.0 bits (99), Expect = 0.005
 Identities = 24/73 (32%), Positives = 38/73 (52%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           M K+K  INI+V+G  +SG+STT GH +YK      + ++ F   +Q   +    +   L
Sbjct: 1   MFKKKEIINIIVLGSTNSGRSTTVGHFLYKLSKECPQLLQYFNTTSQITEEKDIDFTIPL 60

Query: 222 DKLKAEREXVSNR 260
             L+ E E  S +
Sbjct: 61  KNLQFELERNSEQ 73


>UniRef50_Q8ZBP2 Cluster: Sulfate adenylyltransferase subunit 1;
           n=20; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit 1 - Yersinia pestis
          Length = 478

 Score = 87.8 bits (208), Expect = 3e-16
 Identities = 50/141 (35%), Positives = 71/141 (50%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T K    I D PGH  + +NM TG S  D A+L++ A  G  +       Q
Sbjct: 98  IDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLD-------Q 150

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR H+ +A  LG++ L+V VNKMD +          + +  Y   + +L      + FVP
Sbjct: 151 TRRHSFIATLLGIRHLVVAVNKMDLVGFQ--ESVFTQFKDDYLSFAEQLP-TDLDIKFVP 207

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           +S   GDN+  PS KM W+ G
Sbjct: 208 LSALDGDNVASPSEKMDWYSG 228



 Score = 37.5 bits (83), Expect = 0.44
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 7/85 (8%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFK--YAWVL 221
           + KT +  +  G VD GKST  G L++    I +  +     +++ +G    K   A ++
Sbjct: 26  QHKTMLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSTLHTDSKRIGTQGEKLDLALLV 85

Query: 222 DKLKAERE-----XVSNRYCSLEVR 281
           D L+AERE      V+ RY S E R
Sbjct: 86  DGLQAEREQGITIDVAYRYFSTEKR 110


>UniRef50_Q0G239 Cluster: Binfunctional sulfate adenylyltransferase
           subunit 1/adenylylsulfate kinase protein; n=2;
           Aurantimonadaceae|Rep: Binfunctional sulfate
           adenylyltransferase subunit 1/adenylylsulfate kinase
           protein - Fulvimarina pelagi HTCC2506
          Length = 578

 Score = 86.6 bits (205), Expect = 7e-16
 Identities = 53/161 (32%), Positives = 85/161 (52%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F +      I D PGH  + +NM TG SQA+ AV++V A  G          Q
Sbjct: 126 IDVAYRYFSSENRAFIIADTPGHEQYTRNMATGASQAELAVILVDARKGILP-------Q 178

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR H+ +   +G+K +++ +NKMD ++      D  K  R Y     +LG+    V++VP
Sbjct: 179 TRRHSFITSLVGIKSVVIAINKMDLVDFAEERFDAIK--RDYEAILPQLGFTD--VSYVP 234

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALD 738
           +S  +GDN+++ S   PW++G  + ++   AD +   EA D
Sbjct: 235 LSAKNGDNIVKRSPNTPWYQGETLLQRLETADPE-TFEAAD 274



 Score = 46.4 bits (105), Expect = 0.001
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 7/80 (8%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYAWVLDKLKA 236
           +  +  G VD GKST  G L+Y+   +    +E  EK++++ G   G   +A ++D L A
Sbjct: 59  LRFITCGSVDDGKSTLIGRLLYETNAVFDDQMEALEKDSKKFGTTGGDLDFALLVDGLSA 118

Query: 237 ERE-----XVSNRYCSLEVR 281
           ERE      V+ RY S E R
Sbjct: 119 EREQGITIDVAYRYFSSENR 138


>UniRef50_A4LX06 Cluster: Sulfate adenylyltransferase; n=1;
           Geobacter bemidjiensis Bem|Rep: Sulfate
           adenylyltransferase - Geobacter bemidjiensis Bem
          Length = 408

 Score = 86.6 bits (205), Expect = 7e-16
 Identities = 56/141 (39%), Positives = 74/141 (52%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID +   F +      IID PGHR+FI+NM+TG S A  AVLIV A  G  E       Q
Sbjct: 73  IDTSQIYFNSKLRPYLIIDTPGHREFIRNMVTGASYAKAAVLIVDAVEGVME-------Q 125

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR HA L   +G++++ V VNKMD++ +   S                 G +PAA+  VP
Sbjct: 126 TRRHAWLLSIVGIQEICVAVNKMDAVAYS--SDAFAALSVAVESLFTEFGLSPAAI--VP 181

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           IS   GDN+ + S  MPW+ G
Sbjct: 182 ISARVGDNVAKLSGSMPWYTG 202



 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 23/63 (36%), Positives = 36/63 (57%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K+   I + GHVD GKST  G L+Y  G +     ++  + + E G+G  ++A+VLD  +
Sbjct: 6   KSAFPIAITGHVDHGKSTLIGRLLYDTGTLQSGRYQEMLQSSLETGRGD-EFAFVLDAFE 64

Query: 234 AER 242
            ER
Sbjct: 65  EER 67


>UniRef50_A4RWT6 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 481

 Score = 86.2 bits (204), Expect = 1e-15
 Identities = 58/176 (32%), Positives = 86/176 (48%), Gaps = 5/176 (2%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS----KNGQTREHALLAFT 465
           + ++DAPGH+DF+ N I+G SQAD  VL++    G FE G +      GQTREHA LA  
Sbjct: 125 LVVLDAPGHKDFVPNAISGASQADAGVLVIDGAMGGFENGFAATPGHTGQTREHARLARA 184

Query: 466 LGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNML 645
           LG+  LIV +NKMD + +            +       +G++   + FVP+SG  G N+ 
Sbjct: 185 LGLHSLIVVINKMDCVEYGEERFRFVVDALQ-NFLIDDVGFSQEQLTFVPVSGIEGTNIS 243

Query: 646 -EPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARRIXNSV 810
            + +  +P       +       G  L++AL A+  P+R    P   P   I   V
Sbjct: 244 PDDAAALP-------DALASWYRGPTLVDALRAVKIPSRGAPKPLRMPIADIITEV 292



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 26/61 (42%), Positives = 42/61 (68%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 242
           +++V++GHVD+GKST +G L+Y    +D R + K  ++++  GK SF +AWV+D    ER
Sbjct: 45  VHVVILGHVDAGKSTLSGRLMYALKAVDDRAMHKNVRDSKASGKSSFAWAWVMDCRPEER 104

Query: 243 E 245
           E
Sbjct: 105 E 105


>UniRef50_Q9PD78 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=138; root|Rep: Bifunctional
           enzyme cysN/cysC [Includes: Sulfate adenylyltransferase
           subunit 1 (EC 2.7.7.4) (Sulfate adenylate transferase)
           (SAT) (ATP- sulfurylase large subunit); Adenylyl-sulfate
           kinase (EC 2.7.1.25) (APS kinase) (ATP
           adenosine-5'-phosphosulfate 3'-phosphotransferase)] -
           Xylella fastidiosa
          Length = 623

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 49/141 (34%), Positives = 75/141 (53%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F+T K    + D PGH  + +NM TG S AD AV++V A  G          Q
Sbjct: 84  IDVAYRYFDTEKRKFIVADCPGHAQYTRNMATGASTADAAVVLVDARKGLLT-------Q 136

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR H+ +   LG++ +++ VNKMD + +   + +   S   Y   + +LG N   V  +P
Sbjct: 137 TRRHSYIVALLGIRHVVLAVNKMDLVGYDQETFEAIAS--DYLALAAKLGIN--QVQCIP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           +S   GDN+ + S +MPW+ G
Sbjct: 193 LSALEGDNLSKRSARMPWYVG 213



 Score = 41.1 bits (92), Expect = 0.036
 Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 2/79 (2%)
 Frame = +3

Query: 15  QFVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMG- 191
           Q VI D  K  + K  +  +  G VD GKST  GHL+Y    + +  +     ++Q  G 
Sbjct: 2   QSVIAD-LKQQEIKPLLRFITCGSVDDGKSTLIGHLLYDSQCLAEDQLADLMVDSQRYGT 60

Query: 192 KGS-FKYAWVLDKLKAERE 245
           +G    YA +LD L AERE
Sbjct: 61  QGEHIDYALLLDGLAAERE 79


>UniRef50_Q8ZMF5 Cluster: Sulfate adenylyltransferase subunit 1;
           n=38; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit 1 - Salmonella typhimurium
          Length = 479

 Score = 85.4 bits (202), Expect = 2e-15
 Identities = 47/141 (33%), Positives = 71/141 (50%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T +    I D PGH  + +NM TG S  D A+L++ A  G  +       Q
Sbjct: 95  IDVAYRYFSTERRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLD-------Q 147

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR H+ ++  LG+K L+V +NKMD +++        + R  Y   + +L      + FVP
Sbjct: 148 TRRHSFISTLLGIKHLVVAINKMDLVDYR--EETFARIREDYLTFAEQLP-GDLDIRFVP 204

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           +S   GDN+   S  M W+ G
Sbjct: 205 LSALEGDNVAAQSANMRWYSG 225



 Score = 33.9 bits (74), Expect = 5.5
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 7/85 (8%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFK--YAWVL 221
           + K+ +  +  G VD GKST  G L++    I +  +     +++  G    K   A ++
Sbjct: 23  QHKSLLRFLTCGSVDDGKSTLIGRLLHDTLQIYEDQLSSLHNDSKRHGTQGEKLDLALLV 82

Query: 222 DKLKAERE-----XVSNRYCSLEVR 281
           D L+AERE      V+ RY S E R
Sbjct: 83  DGLQAEREQGITIDVAYRYFSTERR 107


>UniRef50_Q10600 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=24; Bacteria|Rep:
           Bifunctional enzyme cysN/cysC [Includes: Sulfate
           adenylyltransferase subunit 1 (EC 2.7.7.4) (Sulfate
           adenylate transferase) (SAT) (ATP- sulfurylase large
           subunit); Adenylyl-sulfate kinase (EC 2.7.1.25) (APS
           kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)] - Mycobacterium tuberculosis
          Length = 614

 Score = 85.4 bits (202), Expect = 2e-15
 Identities = 52/141 (36%), Positives = 73/141 (51%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T K    I D PGH  + +NM+TG S A   +++V A  G  E       Q
Sbjct: 70  IDVAYRYFATPKRKFIIADTPGHIQYTRNMVTGASTAQLVIVLVDARHGLLE-------Q 122

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           +R HA LA  LG++ L++ VNKMD L       D    R ++   + RL      V  +P
Sbjct: 123 SRRHAFLASLLGIRHLVLAVNKMDLLGWDQEKFD--AIRDEFHAFAARLDVQD--VTSIP 178

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           IS  HGDN++  S + PW++G
Sbjct: 179 ISALHGDNVVTKSDQTPWYEG 199



 Score = 38.7 bits (86), Expect = 0.19
 Identities = 21/63 (33%), Positives = 31/63 (49%)
 Frame = +3

Query: 57  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 236
           T + +   G VD GKST  G L+Y    + +      E+ +++ G      A V D L+A
Sbjct: 3   TLLRLATAGSVDDGKSTLIGRLLYDSKAVMEDQWASVEQTSKDRGHDYTDLALVTDGLRA 62

Query: 237 ERE 245
           ERE
Sbjct: 63  ERE 65


>UniRef50_Q08RF5 Cluster: CysN/CysC bifunctional enzyme; n=2;
           Cystobacterineae|Rep: CysN/CysC bifunctional enzyme -
           Stigmatella aurantiaca DW4/3-1
          Length = 574

 Score = 84.6 bits (200), Expect = 3e-15
 Identities = 50/141 (35%), Positives = 71/141 (50%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T +  V + D PGH  + +NM TG S AD AV++  A  G          Q
Sbjct: 115 IDVAYRYFSTPRRKVIVADTPGHIQYTRNMATGASTADAAVILADARLGVLP-------Q 167

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR HA +A  LG+  L V VNKMD ++         +  R+    +R LG+    +   P
Sbjct: 168 TRRHAYIASLLGIPYLAVAVNKMDMVDFDRAV--FERIGRELADFARPLGF--TQIRLFP 223

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           +S   GDN+ + ST+ PW +G
Sbjct: 224 VSARQGDNITQASTRTPWHEG 244



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 15/31 (48%), Positives = 22/31 (70%)
 Frame = +3

Query: 51  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGI 143
           +K  + +VV+G VD GKST  G L+Y+C G+
Sbjct: 20  DKELLRLVVVGSVDDGKSTLIGRLLYECDGL 50


>UniRef50_Q7UMW2 Cluster: Bifunctional enzyme cysN/cysC [Includes:
           Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)
           (Sulfate adenylate transferase) (SAT) (ATP- sulfurylase
           large subunit); Adenylyl-sulfate kinase (EC 2.7.1.25)
           (APS kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)]; n=24; Bacteria|Rep:
           Bifunctional enzyme cysN/cysC [Includes: Sulfate
           adenylyltransferase subunit 1 (EC 2.7.7.4) (Sulfate
           adenylate transferase) (SAT) (ATP- sulfurylase large
           subunit); Adenylyl-sulfate kinase (EC 2.7.1.25) (APS
           kinase) (ATP adenosine-5'-phosphosulfate
           3'-phosphotransferase)] - Rhodopirellula baltica
          Length = 647

 Score = 84.6 bits (200), Expect = 3e-15
 Identities = 48/141 (34%), Positives = 72/141 (51%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T+K    I D PGH  + +NM TG S AD A++++ A  G          Q
Sbjct: 92  IDVAYRYFSTAKRKFIIADTPGHEQYTRNMATGASSADLAIILIDARHGVLT-------Q 144

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR H+ +   LG++ ++V VNKMD            +    Y   + RL  +   + F+P
Sbjct: 145 TRRHSFIVSLLGIRHVVVAVNKMDIDGVDYSEDRFNEICDDYRSFATRL--DLPDLHFIP 202

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           IS  +GDN+++ S  MPW+ G
Sbjct: 203 ISALNGDNLVDRSENMPWYTG 223



 Score = 39.9 bits (89), Expect = 0.083
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 2/71 (2%)
 Frame = +3

Query: 39  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYA 212
           K  ++K  +  +  G VD GKST  G L+Y    + +  + K + ++   G   G F  +
Sbjct: 17  KQHEQKQLLRFITCGSVDDGKSTLIGRLLYDSKLVYEDELAKVQSDSVRQGSVAGGFDPS 76

Query: 213 WVLDKLKAERE 245
             +D LK ERE
Sbjct: 77  LFMDGLKEERE 87


>UniRef50_Q7M9D1 Cluster: GTPASE, SULFATE ADENYLATE TRANSFERASE
           SUBUNIT 1; n=1; Wolinella succinogenes|Rep: GTPASE,
           SULFATE ADENYLATE TRANSFERASE SUBUNIT 1 - Wolinella
           succinogenes
          Length = 459

 Score = 84.2 bits (199), Expect = 4e-15
 Identities = 50/144 (34%), Positives = 83/144 (57%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID A   F++      IIDAPGH +F++NM++G S+A  AVL++ A       G+++N  
Sbjct: 72  IDSARIFFKSQAREYVIIDAPGHIEFLRNMLSGASRAVAAVLVIDA-----IEGVAEN-- 124

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           ++ H LL   LG+ Q++V +NK+D+L +   +      + +Y    + LG  P   AFVP
Sbjct: 125 SKRHGLLLSLLGISQVVVVINKLDALGYDKNA--FLAIQAEYEAYLKTLGITPK--AFVP 180

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQV 687
           IS   G N+++ + +M W++G  V
Sbjct: 181 ISAREGKNLIQKAPEMAWYQGESV 204



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 22/68 (32%), Positives = 37/68 (54%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           M      +NIV+ GHVD GKST  G L+   G + +  +E   +   +  +  F+Y+ +L
Sbjct: 1   MSAHLERMNIVITGHVDHGKSTLVGRLLADTGSLPQGKLESVRESCAKNAR-PFEYSMLL 59

Query: 222 DKLKAERE 245
           D L+ E++
Sbjct: 60  DALEDEQK 67


>UniRef50_Q95UT7 Cluster: Elongation factor 1 alpha short form; n=1;
           Monosiga brevicollis|Rep: Elongation factor 1 alpha
           short form - Monosiga brevicollis
          Length = 208

 Score = 84.2 bits (199), Expect = 4e-15
 Identities = 35/64 (54%), Positives = 51/64 (79%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K H++IV+ GHVD+GKSTTTG LI++ GGI +R ++K + EA+ +GKGSF +A+ +D+ K
Sbjct: 5   KQHVSIVICGHVDAGKSTTTGRLIFELGGIPEREMQKLKDEAERLGKGSFAFAFYMDRQK 64

Query: 234 AERE 245
            ERE
Sbjct: 65  EERE 68



 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 22/29 (75%), Positives = 25/29 (86%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQ 363
           F  +K+Y T+IDAPGHRDFIKNMITG SQ
Sbjct: 81  FTATKHY-TVIDAPGHRDFIKNMITGASQ 108


>UniRef50_UPI000050FE96 Cluster: COG2895: GTPases - Sulfate
           adenylate transferase subunit 1; n=1; Brevibacterium
           linens BL2|Rep: COG2895: GTPases - Sulfate adenylate
           transferase subunit 1 - Brevibacterium linens BL2
          Length = 448

 Score = 83.0 bits (196), Expect = 9e-15
 Identities = 45/141 (31%), Positives = 74/141 (52%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T K    + D PGH  + +NM+TG + AD  V+++ A TG  E       Q
Sbjct: 84  IDVAYRYFATDKRSFILADCPGHVQYTRNMVTGATTADAVVVLIDARTGATE-------Q 136

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR H  +   LG++ +I+ +NK+D L++   +    K   +    +  +G + A +  +P
Sbjct: 137 TRRHLTVVHRLGIRHVILAINKIDLLDYDQAA--YAKVEAEIEALTAEIGLDSAHL--IP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           +S   GDN+ E S   PW++G
Sbjct: 193 VSALAGDNVAEASANTPWYQG 213



 Score = 43.2 bits (97), Expect = 0.009
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMG--KGSFKYAWVLDK 227
           KT +     G VD GKST  G L++    I    +E   + ++E G   G F +A + D 
Sbjct: 14  KTLLRFATAGSVDDGKSTLVGRLLHDAKAILADQLEAVTRTSEERGFVGGEFDFALLTDG 73

Query: 228 LKAERE 245
           L+AERE
Sbjct: 74  LRAERE 79


>UniRef50_A0BL72 Cluster: Chromosome undetermined scaffold_113,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_113,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 609

 Score = 83.0 bits (196), Expect = 9e-15
 Identities = 43/125 (34%), Positives = 72/125 (57%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           ++D+PGH+DF   +I G +QAD A+L+V      FE  I K+G  RE   L   + +K++
Sbjct: 256 LLDSPGHQDFAPYLIAGAAQADYAILVVDTTKNAFENSI-KSGMLREKLQLISAMLIKEI 314

Query: 484 IVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPSTKM 663
           +V +NKMD ++      D+ K   K   ++ +LGYN   + F+PIS + G N ++    +
Sbjct: 315 VVALNKMDQIDWDQKQFDVAKDYIKV--SAAKLGYNQKQIKFIPISAFQGLN-IQNKHNI 371

Query: 664 PWFKG 678
            W++G
Sbjct: 372 NWYQG 376



 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 25/60 (41%), Positives = 39/60 (65%)
 Frame = +3

Query: 66  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           +IV++GHVD+GKST TG L+     +D + + K +K+A+ +GK S   A+  D  K E+E
Sbjct: 176 SIVILGHVDTGKSTLTGRLLQVFKALDDKELRKNQKDAKNLGKESSALAYATDMTKEEKE 235


>UniRef50_P56893 Cluster: Sulfate adenylyltransferase subunit 1;
           n=7; Rhizobiaceae|Rep: Sulfate adenylyltransferase
           subunit 1 - Rhizobium meliloti (Sinorhizobium meliloti)
          Length = 498

 Score = 83.0 bits (196), Expect = 9e-15
 Identities = 49/142 (34%), Positives = 73/142 (51%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T K    + D PGH  + +NM TG S AD AVL+V A  G  E       Q
Sbjct: 100 IDVAYRYFATDKRSFIVADTPGHEQYTRNMATGASTADLAVLLVDARVGLLE-------Q 152

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR HA +A  +G++Q ++ VNK+D  N+     D  +   ++   +  LG     V  +P
Sbjct: 153 TRRHATIATLMGIRQFVLAVNKIDLTNYDRARFD--QISHEFRELALSLGVR--QVTAIP 208

Query: 616 ISGWHGDNML-EPSTKMPWFKG 678
           +S   G+N++ +    MPW+ G
Sbjct: 209 VSALKGENVVYDGRASMPWYDG 230



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 18/76 (23%), Positives = 41/76 (53%), Gaps = 2/76 (2%)
 Frame = +3

Query: 24  IRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA--QEMGKG 197
           +++  ++ ++   + ++  G VD GKST  G L++    + +      ++++  ++   G
Sbjct: 20  VQETARVVRDTRPLRLITCGSVDDGKSTLIGRLLWDTKAVKEDQAASLQRDSSGKQNDLG 79

Query: 198 SFKYAWVLDKLKAERE 245
              +A +LD L+AERE
Sbjct: 80  LPDFALLLDGLQAERE 95


>UniRef50_Q0A978 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Alkalilimnicola ehrlichei MLHE-1|Rep:
           Sulfate adenylyltransferase, large subunit -
           Alkalilimnicola ehrlichei (strain MLHE-1)
          Length = 558

 Score = 82.6 bits (195), Expect = 1e-14
 Identities = 49/142 (34%), Positives = 71/142 (50%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T +    I D PGH  + +NM TG S AD A+L+V A  G          Q
Sbjct: 87  IDVAYRYFATERRKFIIADTPGHEQYTRNMATGASTADVAILLVDAAKGLLP-------Q 139

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR H+ +   LG++ +++ VNKMD +     +   R   R Y   + RLG     VA +P
Sbjct: 140 TRRHSAICALLGIRSVVLAVNKMDRVAWDEAT--FRTIERDYRVLATRLGLE--QVACIP 195

Query: 616 ISGWHGDNML-EPSTKMPWFKG 678
           ++  HGDN++       PW+ G
Sbjct: 196 VAALHGDNVVRRAGPTAPWYTG 217



 Score = 38.3 bits (85), Expect = 0.25
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYAWVLDKLKA 236
           + ++  G VD GKST  G L+Y  G I    +   E+ +   G    S   A ++D L+A
Sbjct: 20  LRLLTCGSVDDGKSTLIGRLLYDAGAIPDDQLAAVERASARYGTTGDSPDLALLVDGLEA 79

Query: 237 ERE 245
           ERE
Sbjct: 80  ERE 82


>UniRef50_Q8AAP9 Cluster: Sulfate adenylyltransferase subunit 1;
           n=17; Bacteria|Rep: Sulfate adenylyltransferase subunit
           1 - Bacteroides thetaiotaomicron
          Length = 485

 Score = 82.6 bits (195), Expect = 1e-14
 Identities = 51/141 (36%), Positives = 73/141 (51%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T+     I D PGH  + +NMITG S A+ A+++V A TG          Q
Sbjct: 87  IDVAYRYFSTNGRKFIIADTPGHEQYTRNMITGGSTANLAIILVDARTGVIT-------Q 139

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR H  L   LG+K +++ VNKMD ++      D   S  +Y      LG     V  +P
Sbjct: 140 TRRHTFLVSLLGIKHVVLAVNKMDLVDFSEERFDEIVS--EYKKFVEPLGI--PDVNCIP 195

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           +S   GDN+++ S + PW+KG
Sbjct: 196 LSALDGDNVVDKSERTPWYKG 216



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 2/68 (2%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGS--FKYAWVL 221
           ++K  + ++  G VD GKST  G L++    + +  ++  E++++ +G       YA +L
Sbjct: 15  EQKDLLRLLTAGSVDDGKSTLIGRLLFDSKKLYEDQLDALERDSKRVGNAGEHIDYALLL 74

Query: 222 DKLKAERE 245
           D LKAERE
Sbjct: 75  DGLKAERE 82


>UniRef50_UPI0000F308E4 Cluster: UPI0000F308E4 related cluster; n=3;
           Laurasiatheria|Rep: UPI0000F308E4 UniRef100 entry - Bos
           Taurus
          Length = 428

 Score = 82.2 bits (194), Expect = 2e-14
 Identities = 68/177 (38%), Positives = 83/177 (46%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I+L +F+TS+ YVTI DA  HRD         S       I  AG   FE  I + G+ R
Sbjct: 74  ISLRQFKTSRGYVTITDASRHRD---------SHTQDGRRI--AG---FETQIRRAGRPR 119

Query: 442 EHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPIS 621
           E AL   TLGVKQL V   K+DS          RKS+    H  ++ G+NP      P S
Sbjct: 120 ERALHTHTLGVKQLSVSATKVDS-QPPCSQKKTRKSKEVSTHV-KKTGFNPDTACVSP-S 176

Query: 622 GWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPAR 792
           GW+GD+MLE  T      G     ++  A G  L EAL  I PP  P   P   P R
Sbjct: 177 GWNGDDMLESRTNCGSGDG-NPTSEDRNAGGATLPEALVCIPPPTHPTDKPLHLPLR 232



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 34/64 (53%), Positives = 38/64 (59%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 227
           K KT    ++ GHVD GKS TTGH IYKC GIDK   EK      E GKGSF+     D 
Sbjct: 3   KNKTRCVSIINGHVDLGKSPTTGHRIYKCDGIDKTATEK-RTRLPETGKGSFESISGSDT 61

Query: 228 LKAE 239
           L+AE
Sbjct: 62  LRAE 65



 Score = 33.5 bits (73), Expect = 7.2
 Identities = 33/114 (28%), Positives = 50/114 (43%), Gaps = 7/114 (6%)
 Frame = +3

Query: 510 TEPPYSEPRFEEIKKEVSSYIKKIGLQPSCCRFRAHFW-----MARRQHVGAFNQNALVQ 674
           ++PP S+ +  +  KEVS+++KK G  P         W     +  R + G+ + N   +
Sbjct: 142 SQPPCSQKKTRK-SKEVSTHVKKTGFNPDTACVSPSGWNGDDMLESRTNCGSGDGNPTSE 200

Query: 675 GM-AGGA*GRQS*RKMPH*SSRCHPATCPXPDKPLRLPCKTYTKFXG-XGTVPV 830
              AGGA        +P  +  C P      DKPL LP +   K  G  G VP+
Sbjct: 201 DRNAGGA-------TLPE-ALVCIPPPTHPTDKPLHLPLRDGHKTSGQAGAVPM 246


>UniRef50_Q2S507 Cluster: Sulfate adenylyltransferase, large subunit
           subfamily, putative; n=5; cellular organisms|Rep:
           Sulfate adenylyltransferase, large subunit subfamily,
           putative - Salinibacter ruber (strain DSM 13855)
          Length = 639

 Score = 82.2 bits (194), Expect = 2e-14
 Identities = 49/141 (34%), Positives = 70/141 (49%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T +    I D PGH  + +NM+TG S A+ AV ++ A  G  E       Q
Sbjct: 78  IDVAYRYFSTPERKFIIADTPGHEQYTRNMVTGASTAELAVELIDARNGVLE-------Q 130

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR H  +   L +  +IV VNKMD + +       R+   +Y   +  L      + FVP
Sbjct: 131 TRRHGFITSLLQIPHVIVAVNKMDLVGYSEAR--FREIVAEYEDFADNLDVQD--ITFVP 186

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           IS   GDN++  S  MPW++G
Sbjct: 187 ISALKGDNVVHHSGNMPWYEG 207



 Score = 37.5 bits (83), Expect = 0.44
 Identities = 21/61 (34%), Positives = 31/61 (50%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 242
           +     G VD GKST  G L+Y    I +  +E+ E+  Q   +   + A + D L+AER
Sbjct: 14  LRFTTAGSVDDGKSTLIGRLMYDTQEIFEEKMEEIERNTQRDDE-ELELALLTDGLRAER 72

Query: 243 E 245
           E
Sbjct: 73  E 73


>UniRef50_Q46516 Cluster: ORFC 179; n=1; Desulfurococcus
           mobilis|Rep: ORFC 179 - Desulfurococcus mobilis
          Length = 179

 Score = 82.2 bits (194), Expect = 2e-14
 Identities = 48/78 (61%), Positives = 50/78 (64%)
 Frame = -1

Query: 506 SILFTPTMSCLTPRVKASKACSRV*PFLEIPASNSPVPAATMSTAQSA*EVPVIMFLMKS 327
           SILF  T++   P V AS ACSRV P   IPASNSP  A T   A SA   PVIMFL KS
Sbjct: 3   SILFIATINWFIPMVLASIACSRVWPSALIPASNSPFLALTTRIAASAWLAPVIMFLTKS 62

Query: 326 LCPGASMMVT*YLLVSNF 273
           L PGASMMV  Y  VSNF
Sbjct: 63  LWPGASMMVKKYFFVSNF 80



 Score = 39.1 bits (87), Expect = 0.15
 Identities = 27/59 (45%), Positives = 33/59 (55%)
 Frame = -2

Query: 244 SRSAFSLSNTQAYLKDPLPISWASFSNFSMVRLSIPPHL*IK*PVVVDLPESTCPMTTM 68
           SRS+F LS++ A LK  LPI   S S    V  S  P      PV+V LP STCP+ T+
Sbjct: 91  SRSSFILSSSHANLKLSLPIFLDSSSIIFTVFSSKYPRRYSMCPVIVLLPWSTCPIITI 149


>UniRef50_Q82L80 Cluster: Putative sulfate adenylyltransferase large
           subunit; n=1; Streptomyces avermitilis|Rep: Putative
           sulfate adenylyltransferase large subunit - Streptomyces
           avermitilis
          Length = 487

 Score = 79.4 bits (187), Expect = 1e-13
 Identities = 50/141 (35%), Positives = 72/141 (51%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T++    + D PGH  + +NM+TG S AD AV++V A  G  E       Q
Sbjct: 87  IDVAYRYFATARRRFILADTPGHVQYTRNMVTGASTADLAVVLVDARNGVIE-------Q 139

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR HA +A  L V  +++ VNKMD + +            K+   +  LG  P   A +P
Sbjct: 140 TRRHAAVAALLRVPHVVLAVNKMDLVEYK--ESVFAAIAEKFTAYASELGV-PEITA-IP 195

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           IS   GDN+++ S  M W+ G
Sbjct: 196 ISALAGDNVVDASANMDWYGG 216



 Score = 37.9 bits (84), Expect = 0.34
 Identities = 20/63 (31%), Positives = 32/63 (50%)
 Frame = +3

Query: 57  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 236
           T +     G VD GKST  G L++    +    +E  E+ ++  G+ +   A + D L+A
Sbjct: 20  TLLRFATAGSVDDGKSTLVGRLLHDSKSVLTDQLEAVEQVSRSRGQDAPDLALLTDGLRA 79

Query: 237 ERE 245
           ERE
Sbjct: 80  ERE 82


>UniRef50_Q7R087 Cluster: GLP_56_7099_8961; n=2; Giardia
           intestinalis|Rep: GLP_56_7099_8961 - Giardia lamblia
           ATCC 50803
          Length = 620

 Score = 79.4 bits (187), Expect = 1e-13
 Identities = 36/70 (51%), Positives = 47/70 (67%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           V + D PGHRDF+ ++I   SQ D AVL++ A   EFE G+S +GQTREH  L    GVK
Sbjct: 233 VFLQDCPGHRDFVPSLIRAVSQPDAAVLVLDASPKEFEKGLSDDGQTREHLQLLMIFGVK 292

Query: 478 QLIVGVNKMD 507
            ++V VNK+D
Sbjct: 293 HIMVAVNKLD 302



 Score = 56.4 bits (130), Expect = 9e-07
 Identities = 26/66 (39%), Positives = 38/66 (57%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDK 227
           K +  IN++V+GHVD+GKST  GHL    G +  R   + +  A    K +F YA++LD 
Sbjct: 139 KSRNTINVLVVGHVDAGKSTIFGHLAVLSGSVSMRERTRTQALADTYNKSTFSYAFLLDT 198

Query: 228 LKAERE 245
              ER+
Sbjct: 199 NDEERQ 204


>UniRef50_Q4G4A5 Cluster: Elongation factor 1A; n=86; Eukaryota|Rep:
           Elongation factor 1A - Echinostelium minutum
          Length = 237

 Score = 79.4 bits (187), Expect = 1e-13
 Identities = 40/91 (43%), Positives = 51/91 (56%)
 Frame = +1

Query: 574 RRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPP 753
           +++GYNP  +AFVPISGWHGDNMLE ST +PW+K            G  L+EALDA+  P
Sbjct: 1   KKIGYNPEKIAFVPISGWHGDNMLEKSTNLPWYK------------GPTLLEALDAVQEP 48

Query: 754 ARPLTSPCVFPARRIXNSVVXVPCPSGRI*N 846
            RP   P   P + +         P GR+ N
Sbjct: 49  KRPTDKPLRVPLQDVYKIGGIGTVPVGRVEN 79


>UniRef50_A2WJZ4 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 806

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 33/63 (52%), Positives = 46/63 (73%)
 Frame = +3

Query: 57  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 236
           + +N+ ++GHVDSGKST +G L++  G I K+ + K EKEA+E GKGSF YAW +D+   
Sbjct: 427 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISKKDMHKNEKEAKEKGKGSFAYAWAMDESSE 486

Query: 237 ERE 245
           ERE
Sbjct: 487 ERE 489



 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 34/119 (28%), Positives = 63/119 (52%)
 Frame = +1

Query: 430 GQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAF 609
           GQT+EHA L  + GV+QLIV VNKMD++ +     +  K   +     R   +  ++V +
Sbjct: 502 GQTKEHAQLIRSFGVEQLIVAVNKMDAIGYSKERFEFIKV--QLGSFLRACNFKDSSVTW 559

Query: 610 VPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFP 786
           +P+S     N+++  + +     +Q         G CL++A+D++  P+R ++ P + P
Sbjct: 560 IPLSAVENQNLIKIPSDVRLTSWYQ---------GFCLLDAIDSLQLPSRDVSKPLILP 609


>UniRef50_A3HVR6 Cluster: Sulfate adenylyltransferase subunit 1;
           n=8; Bacteroidetes|Rep: Sulfate adenylyltransferase
           subunit 1 - Algoriphagus sp. PR1
          Length = 418

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 40/141 (28%), Positives = 71/141 (50%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T K    + D PGH ++ +NM+TG S +  A++++ A  G  E       Q
Sbjct: 73  IDVAHIYFNTDKTNFIVADTPGHVEYTRNMVTGASTSQVAIILIDARKGVIE-------Q 125

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T  H  +A  L +  ++V +NKMD +++        K +  +     +  ++   + F+P
Sbjct: 126 TYRHFFIANLLRISHVVVAINKMDLVDYE--EDVYLKIKADFDELVEKSDFSEDQITFIP 183

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           +S   G+N+   S +MPW+ G
Sbjct: 184 VSALKGENIARQSEEMPWYVG 204



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 23/68 (33%), Positives = 33/68 (48%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 221
           M + +  I I   G VD GKST  G L+Y    +    IE  E+ +++ G     ++   
Sbjct: 1   MSENRKLIKIATAGSVDDGKSTLIGRLLYDTKSLTTDKIEAIERSSKQRGYDYLDFSLAT 60

Query: 222 DKLKAERE 245
           D L AERE
Sbjct: 61  DGLVAERE 68


>UniRef50_Q8NLX2 Cluster: GTPases-Sulfate adenylate transferase
           subunit 1; n=5; Actinomycetales|Rep: GTPases-Sulfate
           adenylate transferase subunit 1 - Corynebacterium
           glutamicum (Brevibacterium flavum)
          Length = 433

 Score = 78.2 bits (184), Expect = 3e-13
 Identities = 49/141 (34%), Positives = 71/141 (50%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T K    + D PGH  + +N +TG S +   VL+V A  G  E       Q
Sbjct: 84  IDVAYRYFATDKRTFILADTPGHVQYTRNTVTGVSTSQVVVLLVDARHGVVE-------Q 136

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR H  ++  LGV+ +I+ VNK+D +++       R   +++   +  L      V  VP
Sbjct: 137 TRRHLSVSALLGVRTVILAVNKIDLVDYS--EEVFRNIEKEFVGLASALDVTDTHV--VP 192

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           IS   GDN+ EPST M W+ G
Sbjct: 193 ISALKGDNVAEPSTHMDWYTG 213



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 19/69 (27%), Positives = 34/69 (49%)
 Frame = +3

Query: 39  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 218
           K+   +T + +   G VD GKST  G L++    +    +   E+ + + G      + +
Sbjct: 12  KIASRET-LRLCTAGSVDDGKSTFVGRLLHDTKSVLADQLASVERTSADRGFEGLDLSLL 70

Query: 219 LDKLKAERE 245
           +D L+AERE
Sbjct: 71  VDGLRAERE 79


>UniRef50_Q5FSE8 Cluster: Sulfate adenylyltransferase subunit 1 /
           adenylylsulfate kinase; n=1; Gluconobacter oxydans|Rep:
           Sulfate adenylyltransferase subunit 1 / adenylylsulfate
           kinase - Gluconobacter oxydans (Gluconobacter
           suboxydans)
          Length = 626

 Score = 78.2 bits (184), Expect = 3e-13
 Identities = 60/181 (33%), Positives = 81/181 (44%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D     F        I+DAPGHR F++NMITG + A+ AVL+V A  G  E       Q
Sbjct: 83  VDSTRIPFRLGSREFVIVDAPGHRQFLRNMITGAADAEAAVLVVDAKEGAQE-------Q 135

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR HA+L   +G++ +IV +NK D L        + K          RL     AV  VP
Sbjct: 136 TRRHAMLLRLIGIRHVIVLLNKSDILGFD--EAQIVKVESDVRQLLGRLEIEVEAV--VP 191

Query: 616 ISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARR 795
            S   GDN+   S +  W+K            G  L+EAL  + PPA     P   P + 
Sbjct: 192 ASARDGDNIASRSERSLWYK------------GPTLVEALANVPPPASRAALPFRMPVQD 239

Query: 796 I 798
           +
Sbjct: 240 V 240



 Score = 43.2 bits (97), Expect = 0.009
 Identities = 19/59 (32%), Positives = 37/59 (62%)
 Frame = +3

Query: 69  IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           IV++GHVD GKST  G L+Y    +    + +  + +++ G  + +++++LD L+ ER+
Sbjct: 21  IVIVGHVDHGKSTLIGRLLYDTDSLQDGKLAQIVESSRKRGL-AVEWSFLLDSLQIERD 78


>UniRef50_Q9UVK1 Cluster: SUP35 homolog; n=1; Pichia pastoris|Rep:
           SUP35 homolog - Pichia pastoris (Yeast)
          Length = 315

 Score = 78.2 bits (184), Expect = 3e-13
 Identities = 33/63 (52%), Positives = 48/63 (76%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K HI+I+ +GHVD+GKST  G+L+Y  G +DKRTI+K+EKEA++ G+  +  +WV+D  K
Sbjct: 238 KDHISILFMGHVDAGKSTMGGNLLYLTGSVDKRTIDKYEKEAKDAGRQGWYLSWVMDTNK 297

Query: 234 AER 242
            ER
Sbjct: 298 EER 300


>UniRef50_P02992 Cluster: Elongation factor Tu, mitochondrial
           precursor; n=1895; cellular organisms|Rep: Elongation
           factor Tu, mitochondrial precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 437

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 39/87 (44%), Positives = 59/87 (67%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I  A  ++ET+K + + +D PGH D+IKNMITG +Q D A+++VAA  G+         Q
Sbjct: 99  ISTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMP-------Q 151

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLN 516
           TREH LLA  +GV+ ++V VNK+D+++
Sbjct: 152 TREHLLLARQVGVQHIVVFVNKVDTID 178



 Score = 34.3 bits (75), Expect = 4.1
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHL---IYKCGGIDKRTIEKFEKEAQEMGKG 197
           + K H+NI  IGHVD GK+T T  +   +   GG +       +K  +E  +G
Sbjct: 44  RSKPHVNIGTIGHVDHGKTTLTAAITKTLAAKGGANFLDYAAIDKAPEERARG 96


>UniRef50_Q1ITG6 Cluster: Sulfate adenylyltransferase, large
           subunit; n=1; Acidobacteria bacterium Ellin345|Rep:
           Sulfate adenylyltransferase, large subunit -
           Acidobacteria bacterium (strain Ellin345)
          Length = 543

 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 47/142 (33%), Positives = 75/142 (52%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T+K    I D PGH  + +NM TG S +D A++++ A  G          Q
Sbjct: 94  IDVAYRYFSTAKRKFIIADTPGHEQYTRNMATGASTSDLAIVLIDARKGVLV-------Q 146

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRR-KYPHTSRRLGYNPAAVAFV 612
           +R H  +A  LG+ +++  +NKMD ++    SP++  +   +       LG  P+ V  +
Sbjct: 147 SRRHLYIAALLGIPRVVATINKMDLVD---FSPEVFAAHSLELKRLGDGLGI-PSLVT-I 201

Query: 613 PISGWHGDNMLEPSTKMPWFKG 678
           PIS   GDN++E S + PW+ G
Sbjct: 202 PISALDGDNVVETSARTPWYDG 223



 Score = 38.3 bits (85), Expect = 0.25
 Identities = 20/64 (31%), Positives = 30/64 (46%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K  + I   G VD GKST  G L+Y    + +  +    +    +G     +A + D L+
Sbjct: 26  KDILRISTAGSVDDGKSTLIGRLLYDSRNVYEDHVRSVTRHDVSLGTSVVDFAQLTDGLR 85

Query: 234 AERE 245
           AERE
Sbjct: 86  AERE 89


>UniRef50_A6GM01 Cluster: Bifunctional sulfate adenylyltransferase
           subunit 1/adenylylsulfate kinase protein; n=1;
           Limnobacter sp. MED105|Rep: Bifunctional sulfate
           adenylyltransferase subunit 1/adenylylsulfate kinase
           protein - Limnobacter sp. MED105
          Length = 575

 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 47/141 (33%), Positives = 70/141 (49%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F+T      + D PGH  + +NM+TG S A  AVL++ A  G          Q
Sbjct: 87  IDVAYRYFQTDARKFIVADTPGHEQYTRNMVTGASTAHLAVLLIDARKGVLT-------Q 139

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR HA L   +G++ L++ VNKMD ++      D  +    +   ++ L     AV  +P
Sbjct: 140 TRRHAFLTQLVGIRHLVLAVNKMDLVDFKQEVYD--RIVADFAGYAKALSIE--AVQAIP 195

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           +S   GDN+ E S   PW+ G
Sbjct: 196 LSAIGGDNLRERSKNTPWYHG 216



 Score = 35.5 bits (78), Expect = 1.8
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK--GSFKYAWVLDKLKA 236
           +  +  G VD GKST  G ++++   + +  +     E++  G    +  YA ++D L A
Sbjct: 20  LRFITCGSVDDGKSTLIGRMLWESQQLFEDQVAALRNESKRYGTQGDNIDYALLVDGLSA 79

Query: 237 ERE 245
           ERE
Sbjct: 80  ERE 82


>UniRef50_Q9RGE9 Cluster: Sulfate adenylyltransferase subunit CysN;
           n=7; Proteobacteria|Rep: Sulfate adenylyltransferase
           subunit CysN - Campylobacter jejuni
          Length = 472

 Score = 76.6 bits (180), Expect = 8e-13
 Identities = 43/143 (30%), Positives = 74/143 (51%), Gaps = 2/143 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F ++K    I D PGH  + +NM TG S AD A++++ A  G  +       Q
Sbjct: 85  IDVAYRFFTSNKRKFIIADTPGHEQYTRNMATGASTADIAIILIDARKGVLK-------Q 137

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNH-HTVSPDLRKSRRK-YPHTSRRLGYNPAAVAF 609
           T+ H+ +   LG+K  I+ +NKMD +++   +  ++ K   K  P+    +        F
Sbjct: 138 TKRHSYIVSLLGIKNFIIAINKMDLVSYEEKIFNNICKDYEKIIPYLQEDI-----QTHF 192

Query: 610 VPISGWHGDNMLEPSTKMPWFKG 678
           +PI   +G+N+ + S  + W+KG
Sbjct: 193 IPICALNGENITQKSRNLSWYKG 215



 Score = 41.5 bits (93), Expect = 0.027
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 2/68 (2%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFK--YAWVL 221
           + K     +  G VD GKST  G L+Y    +    +   EK++++MG    K  +A ++
Sbjct: 13  ENKELCRFITCGSVDDGKSTLIGRLLYDTKALFSDQLSTLEKDSKKMGNAGDKLDFALLV 72

Query: 222 DKLKAERE 245
           D L +ERE
Sbjct: 73  DGLASERE 80


>UniRef50_Q0SH95 Cluster: CysN/CysC bifunctional enzyme; n=14;
           Actinomycetales|Rep: CysN/CysC bifunctional enzyme -
           Rhodococcus sp. (strain RHA1)
          Length = 627

 Score = 76.2 bits (179), Expect = 1e-12
 Identities = 49/141 (34%), Positives = 71/141 (50%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T      + D PGH  + +NM TG S A  AVL+V A      AG+ +  Q
Sbjct: 71  IDVAYRFFSTPTRSFVLADTPGHERYTRNMFTGASNAHVAVLLVDA-----RAGVLR--Q 123

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           TR HA +A  LGV  L+  VNK+D ++        ++   +    ++RLG     V  +P
Sbjct: 124 TRRHARIADLLGVPHLVAVVNKIDLVDFDETR--FKEVESELGLLAQRLGGRDLTV--IP 179

Query: 616 ISGWHGDNMLEPSTKMPWFKG 678
           +S   GDN++  S   PW+ G
Sbjct: 180 VSATRGDNVVTRSDSTPWYDG 200


>UniRef50_A4SYY3 Cluster: Sulfate adenylyltransferase, large
           subunit; n=13; Proteobacteria|Rep: Sulfate
           adenylyltransferase, large subunit - Polynucleobacter
           sp. QLW-P1DMWA-1
          Length = 447

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 42/142 (29%), Positives = 73/142 (51%), Gaps = 1/142 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE-AGISKNG 432
           ID+A   F T K    + DAPGH  + +N++TG SQ+D AV++V A   +      +   
Sbjct: 78  IDVAYRYFSTPKRKFIVADAPGHEQYTRNLVTGASQSDVAVILVDATRVDLSTTPATLLA 137

Query: 433 QTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFV 612
           QT+ HA +   LG++ ++  +NKMD  +      +  K+       ++++G     +  +
Sbjct: 138 QTKRHAAIVHLLGLRHVVFAINKMDLFDFDEKVYNTIKA--SIEDLTQKIGLPKRTL--I 193

Query: 613 PISGWHGDNMLEPSTKMPWFKG 678
           PIS   G N++  S   PW++G
Sbjct: 194 PISALLGANVVTASKNTPWYQG 215


>UniRef50_Q45W23 Cluster: Tuf1; n=1; uncultured Pseudonocardia
           sp.|Rep: Tuf1 - uncultured Pseudonocardia sp
          Length = 230

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 38/91 (41%), Positives = 55/91 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I IA  +++T K +   +D PGH D++KNMITG +Q D A+L+VAA  G          Q
Sbjct: 1   ISIAHVEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMP-------Q 53

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTV 528
           TREH LLA  +GV  ++V +NK D ++   +
Sbjct: 54  TREHVLLARQVGVPYIVVALNKADMVDDEEI 84


>UniRef50_A4VDD2 Cluster: Elongation factor 1-alpha; n=1;
           Tetrahymena thermophila SB210|Rep: Elongation factor
           1-alpha - Tetrahymena thermophila SB210
          Length = 356

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 31/63 (49%), Positives = 48/63 (76%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           K H+++ V G VDSGKSTT GHL++K G +++R I++ +  A++ GK SF +A+V+D+ K
Sbjct: 4   KQHLSVAVFGDVDSGKSTTCGHLVFKLGEVNQRKIDELKALAEKEGKSSFGFAYVMDRTK 63

Query: 234 AER 242
           AER
Sbjct: 64  AER 66



 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 27/75 (36%), Positives = 42/75 (56%)
 Frame = +1

Query: 574 RRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALDAILPP 753
           +++G+N   V+F+PISG+ G N+ E S  MPW+K            G  ++EALD++ PP
Sbjct: 99  QKIGFNLKNVSFIPISGYIGHNLTEKSESMPWYK------------GNTVLEALDSVTPP 146

Query: 754 ARPLTSPCVFPARRI 798
            RP+      P + I
Sbjct: 147 TRPVEKDLRIPIQGI 161


>UniRef50_A0JZN0 Cluster: Sulfate adenylyltransferase, large
           subunit; n=2; Arthrobacter|Rep: Sulfate
           adenylyltransferase, large subunit - Arthrobacter sp.
           (strain FB24)
          Length = 477

 Score = 73.7 bits (173), Expect = 6e-12
 Identities = 49/145 (33%), Positives = 69/145 (47%), Gaps = 4/145 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T +    + D PGH  + KN +TG S AD  V+++ A  G  E       Q
Sbjct: 98  IDVAYRYFATDRRSFILADCPGHVQYTKNTVTGASTADAVVVLIDARKGVLE-------Q 150

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDL-RKSRRKYPHTSRRLGYNPAAVA-- 606
           TR H  +   L V  +IV VNK+D ++    S D+ R          R LG     +   
Sbjct: 151 TRRHLSVLQLLRVAHVIVAVNKIDLVD---FSEDVFRGIEADVQKVGRELGLGADGITDL 207

Query: 607 -FVPISGWHGDNMLEPSTKMPWFKG 678
             VP+S   GDN++E S + PW+ G
Sbjct: 208 LVVPVSALDGDNVVERSERTPWYTG 232


>UniRef50_UPI0000499770 Cluster: elongation factor-1alpha; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: elongation
           factor-1alpha - Entamoeba histolytica HM-1:IMSS
          Length = 544

 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 32/63 (50%), Positives = 43/63 (68%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 233
           +T + ++  GHVDSGKSTT GH++ + GG+    IEK +KE  E GK SF+YAWV+D   
Sbjct: 130 QTPLTVIFCGHVDSGKSTTVGHILQELGGVTHSQIEKNKKECGEKGKKSFEYAWVMDTDD 189

Query: 234 AER 242
            ER
Sbjct: 190 EER 192



 Score = 57.6 bits (133), Expect = 4e-07
 Identities = 36/139 (25%), Positives = 68/139 (48%), Gaps = 1/139 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I +   +F+ +   + I+DAPGH DF+   I   ++AD AV++V       +   +  G 
Sbjct: 198 ISVGAVEFQYNHKNIRILDAPGHTDFLMKTIDAMNEADVAVVVVDVDKHNLKC--TYEGT 255

Query: 436 TRE-HALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFV 612
             +  + LA++  V ++IV +NKMDS+         +          +    +   + ++
Sbjct: 256 FLDIVSTLAYST-VSKIIVAINKMDSVKWS--ESKYKSVVSVAEELLKEYNLDNINIRYI 312

Query: 613 PISGWHGDNMLEPSTKMPW 669
           PISG  G+N+++P+T   W
Sbjct: 313 PISGLSGENLIKPTTSCKW 331


>UniRef50_P18905 Cluster: Elongation factor Tu; n=2;
           Coleochaetales|Rep: Elongation factor Tu - Coleochaete
           orbicularis
          Length = 415

 Score = 72.9 bits (171), Expect = 1e-11
 Identities = 61/178 (34%), Positives = 86/178 (48%), Gaps = 3/178 (1%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           ++ET+  + + +D PGH ++I NMITG SQ D A+L+V+A  G          QT+EH L
Sbjct: 72  EYETAARHYSHLDCPGHVNYINNMITGVSQMDGAILVVSAVDGPM-------AQTKEHIL 124

Query: 454 LAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHG 633
           LA  LG+  ++V +NK D L+   V P L ++ R+       L Y        PI     
Sbjct: 125 LAKLLGISSILVFINKEDELDDQEVLPMLIQNMRQI------LIYYGFPGHTSPILCGSA 178

Query: 634 DNMLEPSTKMPWFKGWQVERKEGKADGK--CLIEALDAILP-PARPLTSPCVFPARRI 798
              LE   + P F      R + K   K   LI+ LD  LP P R L  P + P  R+
Sbjct: 179 LLALEAMNENPNF-----NRGKNKWVDKISSLIDHLDLYLPTPRRKLNKPFLMPIERV 231


>UniRef50_Q5BEE6 Cluster: Elongation factor Tu; n=1; Emericella
           nidulans|Rep: Elongation factor Tu - Emericella nidulans
           (Aspergillus nidulans)
          Length = 461

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 37/87 (42%), Positives = 55/87 (63%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I  A  +F T   +   +D PGH D+IKNMITG +  D A+++VAA  G+         Q
Sbjct: 103 ISTAHIEFSTDNRHYAHVDCPGHADYIKNMITGAANMDGAIVVVAASDGQMP-------Q 155

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLN 516
           TREH LLA  +GV++++V VNK+D+++
Sbjct: 156 TREHLLLARQVGVQKIVVFVNKVDAVD 182


>UniRef50_Q8IE20 Cluster: Elongation factor tu, putative; n=9;
           Aconoidasida|Rep: Elongation factor tu, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 505

 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 36/78 (46%), Positives = 54/78 (69%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           ++ET K + + ID PGH D+IKNMITGTSQ D ++L+V+A  G          QT+EH L
Sbjct: 178 EYETEKRHYSHIDCPGHLDYIKNMITGTSQMDGSILVVSAYDGLMP-------QTKEHVL 230

Query: 454 LAFTLGVKQLIVGVNKMD 507
           L+  +G++++IV +NK+D
Sbjct: 231 LSRQIGIEKMIVYLNKID 248



 Score = 40.3 bits (90), Expect = 0.063
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 3/53 (5%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDK---RTIEKFEKEAQEMGKG 197
           ++K H+NI  IGHVD GK+T T  +   C  +++   ++ E+ +K  +E  +G
Sbjct: 117 RKKPHMNIGTIGHVDHGKTTLTAAITKVCSDLNRGVFKSYEEIDKTPEEQKRG 169


>UniRef50_A1W6V4 Cluster: Sulfate adenylyltransferase, large
           subunit; n=9; Burkholderiales|Rep: Sulfate
           adenylyltransferase, large subunit - Acidovorax sp.
           (strain JS42)
          Length = 462

 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 47/132 (35%), Positives = 70/132 (53%), Gaps = 1/132 (0%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE-AGISKNG 432
           ID+A   F T      I DAPGH  + +NM+T  SQAD AV++V A   +++   ++   
Sbjct: 87  IDVAYRYFATEARKFIIGDAPGHEQYTRNMVTAASQADAAVVLVDATKLDWQNPQLTLLP 146

Query: 433 QTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFV 612
           QTR H+LL   L V  L+  VNK+D++    ++   R  R      +R  G + A V  V
Sbjct: 147 QTRRHSLLVHLLRVHSLVFAVNKLDAVADPQLA--YRHIRAALEQFARHAGIDVAGV--V 202

Query: 613 PISGWHGDNMLE 648
           P+S   G N++E
Sbjct: 203 PVSALKGWNVVE 214


>UniRef50_Q5CWA0 Cluster: HBS1 eRFS. GTpase; n=2;
           Cryptosporidium|Rep: HBS1 eRFS. GTpase - Cryptosporidium
           parvum Iowa II
          Length = 530

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 31/58 (53%), Positives = 40/58 (68%)
 Frame = +3

Query: 72  VVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           VV+GHVDSGKST  GHL    G I +  + K++KE++ +GKGSF YAW+ D    ERE
Sbjct: 85  VVLGHVDSGKSTLMGHLFVSLGLISEGVMRKYKKESEIIGKGSFAYAWIFDDCDDERE 142



 Score = 67.3 bits (157), Expect = 5e-10
 Identities = 46/148 (31%), Positives = 74/148 (50%), Gaps = 7/148 (4%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I+I+       K  VTI+DAPGH +FI N  + +  +D  +++V   +G F++G  K GQ
Sbjct: 147 INISAKSMMIEKKLVTILDAPGHSEFIPNSFSISMFSD-NIIVVIDSSG-FDSGFQK-GQ 203

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLN-HHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFV 612
           T EH + +    V  +I  VNK+D  N    V  ++  +   Y +       N + + F+
Sbjct: 204 TIEHIIYSLLADVSNIIFAVNKLDLCNWDEQVYSNIVNTISNYINLELADIKNDSNIIFL 263

Query: 613 PISGWHGDNMLE------PSTKMPWFKG 678
           PIS +HG N+L       P     W++G
Sbjct: 264 PISAYHGVNILNDKNNTFPKELSSWYQG 291


>UniRef50_A0EFI6 Cluster: Elongation factor Tu; n=3; Paramecium
           tetraurelia|Rep: Elongation factor Tu - Paramecium
           tetraurelia
          Length = 471

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 41/108 (37%), Positives = 61/108 (56%), Gaps = 4/108 (3%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I+ A  +++T   +   +D PGH D++KNMITG ++ D A+L+VAA  G          Q
Sbjct: 82  INSATVEYQTKTRHYGHVDCPGHIDYVKNMITGAAKMDAAILVVAATDGCM-------AQ 134

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLN----HHTVSPDLRKSRRKYPH 567
           TREH LL   +GV+ +IV VNK+D       H  V  ++R+   KY +
Sbjct: 135 TREHVLLCRQVGVETIIVFVNKIDLAKDPEIHELVEMEIRELLSKYEY 182



 Score = 33.5 bits (73), Expect = 7.2
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = +3

Query: 39  KMGKEKTHINIVVIGHVDSGKSTTT 113
           K  ++K H+N+  IGH+D GK+T T
Sbjct: 24  KFVRDKPHLNVGTIGHIDHGKTTLT 48


>UniRef50_Q0EDG4 Cluster: Mitochondrial EF-Tu2; n=1; Trichinella
           britovi|Rep: Mitochondrial EF-Tu2 - Trichinella britovi
          Length = 428

 Score = 70.1 bits (164), Expect = 7e-11
 Identities = 37/87 (42%), Positives = 53/87 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I IA   +ET K   +  D PGH+DFIKNMI G +Q D A+L+V A  G          Q
Sbjct: 79  ISIAHVGYETKKRKYSHTDCPGHKDFIKNMICGATQMDAAILVVDAAEGTMP-------Q 131

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLN 516
           TREH +LA  +GV++++V +NK + ++
Sbjct: 132 TREHVMLAKQVGVQRIVVFINKAEMVD 158


>UniRef50_UPI0000EB403C Cluster: UPI0000EB403C related cluster; n=1;
           Canis lupus familiaris|Rep: UPI0000EB403C UniRef100
           entry - Canis familiaris
          Length = 300

 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 41/110 (37%), Positives = 54/110 (49%)
 Frame = +1

Query: 469 GVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLE 648
           G+KQLIVG  K+D     + S    K   +     +++GY+P  VAF  IS W+GD+M E
Sbjct: 1   GMKQLIVGGGKVD-FTESSYSQKRDKEPVRESTYIKKIGYHPDTVAFASISIWNGDDMPE 59

Query: 649 PSTKMPWFKGWQVERKEGKADGKCLIEALDAILPPARPLTSPCVFPARRI 798
           PS  M     W+V    G      L+E LD ILPP  P       P + I
Sbjct: 60  PSANM----AWKVTHNHGNTSETMLLEVLDCILPPTCPTDKSLHLPLQDI 105


>UniRef50_P91150 Cluster: Tu elongation factor (Ef-tu),
           mitochondrial protein 2; n=5; Chromadorea|Rep: Tu
           elongation factor (Ef-tu), mitochondrial protein 2 -
           Caenorhabditis elegans
          Length = 439

 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 38/84 (45%), Positives = 51/84 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I++A   +E+     +  D PGH DFIKNMI GTSQ D AVL++AA  G  E       Q
Sbjct: 96  INVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVME-------Q 148

Query: 436 TREHALLAFTLGVKQLIVGVNKMD 507
           T+EH +LA  +GVK + + +NK D
Sbjct: 149 TKEHLILAKQVGVKNMAIFINKAD 172


>UniRef50_Q4U972 Cluster: Translation elongation factor 1-alpha,
           putative; n=3; Theileria|Rep: Translation elongation
           factor 1-alpha, putative - Theileria annulata
          Length = 577

 Score = 68.9 bits (161), Expect = 2e-10
 Identities = 39/128 (30%), Positives = 67/128 (52%), Gaps = 1/128 (0%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           V +ID PGH D I+N++ G   A+ A++IV   + +            EH LL + LG++
Sbjct: 188 VNVIDTPGHHDLIQNLVMGAVFANSAIIIV--DSNDVLKSDFFGVYFSEHMLLLYLLGIR 245

Query: 478 QLIVGVNKMDSLNH-HTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPS 654
            +I+ VNK+D   +  T+   + +  RK      +       + F+P+SG  GDN+++ S
Sbjct: 246 YIIICVNKIDRFEYSETMYNKVVEIIRKLVVVYEK----SVKLIFLPVSGLRGDNLIDKS 301

Query: 655 TKMPWFKG 678
             + W+KG
Sbjct: 302 NNLSWYKG 309



 Score = 35.5 bits (78), Expect = 1.8
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGIDKR 152
           +N+VV+G VD+GKST  GH +     +DK+
Sbjct: 98  LNVVVLGAVDAGKSTLLGHFLTLTNCVDKK 127


>UniRef50_Q7K3V6 Cluster: Elongation factor Tu; n=7; Coelomata|Rep:
           Elongation factor Tu - Drosophila melanogaster (Fruit
           fly)
          Length = 456

 Score = 68.1 bits (159), Expect = 3e-10
 Identities = 35/84 (41%), Positives = 52/84 (61%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 456
           + T++      D PGH D+IKNMI+G SQ D A+L+VAA  G+         QTREH LL
Sbjct: 115 YSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP-------QTREHLLL 167

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTV 528
           A  +G++++IV +NK D ++   +
Sbjct: 168 AKQVGIQRIIVFINKADLVDQEVL 191


>UniRef50_P49411 Cluster: Elongation factor Tu, mitochondrial
           precursor; n=73; cellular organisms|Rep: Elongation
           factor Tu, mitochondrial precursor - Homo sapiens
           (Human)
          Length = 452

 Score = 68.1 bits (159), Expect = 3e-10
 Identities = 36/86 (41%), Positives = 52/86 (60%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I+ A  ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G          Q
Sbjct: 108 INAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP-------Q 160

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSL 513
           TREH LLA  +GV+ ++V VNK D++
Sbjct: 161 TREHLLLARQIGVEHVVVYVNKADAV 186



 Score = 37.9 bits (84), Expect = 0.34
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 197
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 53  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 105


>UniRef50_Q4QDW8 Cluster: Elongation factor TU, putative; n=5;
           Trypanosomatidae|Rep: Elongation factor TU, putative -
           Leishmania major
          Length = 466

 Score = 67.7 bits (158), Expect = 4e-10
 Identities = 37/99 (37%), Positives = 56/99 (56%), Gaps = 3/99 (3%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           ++E+ K +   ID PGH DF+KNMITG +Q D  +++VAA  G          QTREH L
Sbjct: 80  EYESEKRHYGHIDCPGHMDFVKNMITGAAQMDGGIIVVAATDGVMP-------QTREHLL 132

Query: 454 LAFTLGVKQLIVGVNKMDSLNHHT---VSPDLRKSRRKY 561
           +   +G+  L+  +NK+D  +  T   V  ++R+   KY
Sbjct: 133 ICSQIGLPALVGFINKVDMTDEDTCDLVDMEVREQLEKY 171


>UniRef50_Q19072 Cluster: Elongation factor Tu homologue precursor
           (Tu elongation factor (Ef- tu), mitochondrial protein
           1); n=7; Nematoda|Rep: Elongation factor Tu homologue
           precursor (Tu elongation factor (Ef- tu), mitochondrial
           protein 1) - Caenorhabditis elegans
          Length = 496

 Score = 66.9 bits (156), Expect = 6e-10
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           ++ET+K +   ID PGH D+IKNMITG +Q + A+L+VAA  G          QTREH L
Sbjct: 107 EYETAKRHYAHIDCPGHADYIKNMITGAAQMEGAILVVAATDGPMP-------QTREHLL 159

Query: 454 LAFTLGV--KQLIVGVNKMDSL 513
           LA  +GV    ++V +NK+D +
Sbjct: 160 LARQVGVPLDNIVVFMNKVDEV 181



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 218
           ++K H+N+  IGHVD GK+T T     ++    G   R  E  +   +E  +G    A+ 
Sbjct: 46  RDKPHLNVGTIGHVDHGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFH 105

Query: 219 LDKLKAER 242
           L+   A+R
Sbjct: 106 LEYETAKR 113


>UniRef50_Q8TYZ3 Cluster: GTPase-translation elongation factor; n=1;
           Methanopyrus kandleri|Rep: GTPase-translation elongation
           factor - Methanopyrus kandleri
          Length = 459

 Score = 66.9 bits (156), Expect = 6e-10
 Identities = 34/100 (34%), Positives = 55/100 (55%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+    FE   Y VT++DAPGH D I+ ++ G    D A+L+VAA  G          Q
Sbjct: 45  IDLGFSSFELGDYTVTLVDAPGHADLIRTVVAGAEIIDAAILVVAADEG-------PQVQ 97

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRR 555
           T EH ++   LG+ + ++ +NK+D ++  TV   + + +R
Sbjct: 98  TGEHLVVLNHLGIDRGVIALNKVDLVDEKTVERRIEEIKR 137


>UniRef50_UPI00006CBD5B Cluster: Elongation factor Tu, mitochondrial
           precursor, putative; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu, mitochondrial
           precursor, putative - Tetrahymena thermophila SB210
          Length = 375

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 35/84 (41%), Positives = 49/84 (58%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I+ A  ++ET   +   +D PGH D++KNMITG ++ D  +L+ +A  G          Q
Sbjct: 84  INTATVEYETETRHYGHVDCPGHIDYVKNMITGAAKMDAGILVCSATDGVMP-------Q 136

Query: 436 TREHALLAFTLGVKQLIVGVNKMD 507
           TREH LL   +GVK +IV VNK D
Sbjct: 137 TREHILLCRQVGVKTIIVFVNKCD 160



 Score = 35.5 bits (78), Expect = 1.8
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = +3

Query: 39  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIE 161
           K  + K H+N+  IGH+D GK+T T  +   C   DK+  E
Sbjct: 26  KFQRNKPHLNVGTIGHIDHGKTTLTAAITKICA--DKKLAE 64


>UniRef50_Q9UVK0 Cluster: SUP35 homolog; n=1; Saccharomycodes
           ludwigii|Rep: SUP35 homolog - Saccharomycodes ludwigii
          Length = 305

 Score = 64.9 bits (151), Expect = 3e-09
 Identities = 26/50 (52%), Positives = 40/50 (80%)
 Frame = +3

Query: 54  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSF 203
           K H++++ +GHVD+GKST  G+L+Y  G +DKRTIEK+E+EA++ G+  F
Sbjct: 256 KDHMSLLFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRFCF 305


>UniRef50_O83217 Cluster: Elongation factor Tu; n=7; cellular
           organisms|Rep: Elongation factor Tu - Treponema pallidum
          Length = 395

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 32/78 (41%), Positives = 49/78 (62%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           ++++ + +   ID PGH D++KNMITG +Q D  +L+V+A  G          QT+EH L
Sbjct: 69  EYQSDRRHYAHIDCPGHADYVKNMITGAAQMDGGILVVSAPDGVMP-------QTKEHLL 121

Query: 454 LAFTLGVKQLIVGVNKMD 507
           LA  +GV  +IV +NK+D
Sbjct: 122 LARQVGVPSIIVFLNKVD 139



 Score = 34.3 bits (75), Expect = 4.1
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 3/56 (5%)
 Frame = +3

Query: 39  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG---GIDKRTIEKFEKEAQEMGKG 197
           K  + K H+N+  IGHVD GK+T +  +   C    G  +   ++ +   +E  +G
Sbjct: 5   KFARTKVHMNVGTIGHVDHGKTTLSAAITSYCAKKFGDKQLKYDEIDNAPEEKARG 60


>UniRef50_Q1FK57 Cluster: Small GTP-binding protein domain:Sulfate
           adenylyltransferase, large subunit; n=3;
           Clostridiales|Rep: Small GTP-binding protein
           domain:Sulfate adenylyltransferase, large subunit -
           Clostridium phytofermentans ISDg
          Length = 563

 Score = 60.1 bits (139), Expect = 7e-08
 Identities = 36/140 (25%), Positives = 65/140 (46%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+A   F T      + D PGH ++ +NM  G S A   ++++ A  G          Q
Sbjct: 71  IDVAYRYFTTKNRSFIVADTPGHEEYTRNMAVGASFAQLTIILIDAKQGVLL-------Q 123

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           T+ H+ +   +G+   +  VNKMD +++        + +R     ++ L  +   V  +P
Sbjct: 124 TKRHSRICSFMGIHHFVFAVNKMDLVDYS--EERFLEIKRNILELAKDLSLH--NVKIIP 179

Query: 616 ISGWHGDNMLEPSTKMPWFK 675
           +S   GDN+ + S  M W++
Sbjct: 180 VSATLGDNVTKKSDHMNWYE 199



 Score = 38.7 bits (86), Expect = 0.19
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIY--KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 236
           +  +  G VD GKST  GH++Y  K    D+      + +    G G   Y+ +LD L+A
Sbjct: 5   LKFITCGSVDDGKSTLIGHILYDSKLLYTDQENALMLDSKVGSRG-GEIDYSLLLDGLEA 63

Query: 237 ERE 245
           ERE
Sbjct: 64  ERE 66


>UniRef50_Q25820 Cluster: Elongation factor Tu; n=99; cellular
           organisms|Rep: Elongation factor Tu - Plasmodium
           falciparum
          Length = 410

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 31/78 (39%), Positives = 45/78 (57%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           ++ET   +   ID PGH D+IKNMI G +Q D A+L+++   G          QT EH L
Sbjct: 69  EYETLTKHCAHIDCPGHSDYIKNMIIGATQMDIAILVISIIDGIMP-------QTYEHLL 121

Query: 454 LAFTLGVKQLIVGVNKMD 507
           L   +G+K +I+ +NK D
Sbjct: 122 LIKQIGIKNIIIFLNKED 139



 Score = 33.9 bits (74), Expect = 5.5
 Identities = 14/27 (51%), Positives = 18/27 (66%)
 Frame = +3

Query: 48  KEKTHINIVVIGHVDSGKSTTTGHLIY 128
           + K HIN+  IGHVD GK+T T  + Y
Sbjct: 8   RNKQHINLGTIGHVDHGKTTLTTAISY 34


>UniRef50_UPI00006A2885 Cluster: UPI00006A2885 related cluster; n=1;
           Xenopus tropicalis|Rep: UPI00006A2885 UniRef100 entry -
           Xenopus tropicalis
          Length = 315

 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 30/71 (42%), Positives = 41/71 (57%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           ++ T+  +    D PGH D++KNMITGTSQ D  +L+VAA  G+         QTREH L
Sbjct: 38  EYATANRHYAHTDCPGHADYVKNMITGTSQMDGCILVVAATDGQMP-------QTREHLL 90

Query: 454 LAFTLGVKQLI 486
           LA    +  L+
Sbjct: 91  LAKQANIHTLV 101


>UniRef50_A1HSM1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Thermosinus carboxydivorans
           Nor1|Rep: Selenocysteine-specific translation elongation
           factor - Thermosinus carboxydivorans Nor1
          Length = 623

 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 28/71 (39%), Positives = 41/71 (57%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           ++D PGH  F+KNM+ GT   D A+L+VAA  G          QTREH  +    G+ Q 
Sbjct: 58  VVDVPGHERFLKNMLAGTGGIDMAMLVVAADEGVMP-------QTREHLAMLHLYGISQG 110

Query: 484 IVGVNKMDSLN 516
           +V +NK+D ++
Sbjct: 111 VVVLNKIDKVD 121


>UniRef50_Q4JIN1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; uncultured bacterium
           BAC10-10|Rep: Selenocysteine-specific translation
           elongation factor - uncultured bacterium BAC10-10
          Length = 634

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 28/75 (37%), Positives = 40/75 (53%)
 Frame = +1

Query: 283 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 462
           ++ + + I+D PGH DF+KNM+ G    D A+LIVAA  G          QT EH  +  
Sbjct: 59  SASFLLGIVDVPGHEDFVKNMVAGVGSIDLALLIVAADDGWMP-------QTEEHLQILT 111

Query: 463 TLGVKQLIVGVNKMD 507
             GV+  +V + K D
Sbjct: 112 YFGVRHAVVALTKAD 126


>UniRef50_A6CK31 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Bacillus sp. SG-1|Rep:
           Selenocysteine-specific translation elongation factor -
           Bacillus sp. SG-1
          Length = 630

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 30/79 (37%), Positives = 43/79 (54%)
 Frame = +1

Query: 280 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 459
           ET    ++++D PGH  FIK MI G +  D  +L+VAA  G          QT+EH  + 
Sbjct: 52  ETEDMDISVVDVPGHEKFIKQMIAGVAGIDLVILVVAADEGVMP-------QTKEHLEIL 104

Query: 460 FTLGVKQLIVGVNKMDSLN 516
             LGV   IV ++KMD ++
Sbjct: 105 SFLGVDHGIVVLSKMDKVD 123


>UniRef50_Q1AUJ9 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Rubrobacter xylanophilus DSM
           9941|Rep: Selenocysteine-specific translation elongation
           factor - Rubrobacter xylanophilus (strain DSM 9941 /
           NBRC 16129)
          Length = 612

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 26/75 (34%), Positives = 45/75 (60%)
 Frame = +1

Query: 301 TIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 480
           +++D PGH  F+KNM+ G++  D  +L++AA  G          QTREH  +   LGV++
Sbjct: 61  SLVDVPGHERFVKNMVAGSTGVDAFLLVIAADDGVMP-------QTREHLDVLRVLGVER 113

Query: 481 LIVGVNKMDSLNHHT 525
            +V + K+D+++  T
Sbjct: 114 GVVALTKIDAVDAET 128


>UniRef50_A3SGF9 Cluster: Translation elongation factor,
           selenocysteine-specific; n=2; Sulfitobacter|Rep:
           Translation elongation factor, selenocysteine-specific -
           Sulfitobacter sp. EE-36
          Length = 623

 Score = 53.6 bits (123), Expect = 6e-06
 Identities = 31/68 (45%), Positives = 42/68 (61%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           +IDAPGH DFI+ M++G S A  A+L+V+A       GI+   QTREH  +A  L V   
Sbjct: 57  LIDAPGHEDFIRTMVSGASGAQGAMLVVSA-----VEGIA--AQTREHVQIARLLQVPVA 109

Query: 484 IVGVNKMD 507
           +V V K+D
Sbjct: 110 VVAVTKVD 117


>UniRef50_Q2B7L6 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Bacillus sp. NRRL B-14911|Rep:
           Selenocysteine-specific translation elongation factor -
           Bacillus sp. NRRL B-14911
          Length = 618

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 28/84 (33%), Positives = 45/84 (53%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 456
           +E     V++ID PGH  FI+ MI G +  D  +L+VAA  G          QT+EH  +
Sbjct: 42  YEDEDLEVSVIDVPGHERFIRQMIAGVAGIDLVILVVAADEGVMP-------QTKEHLQI 94

Query: 457 AFTLGVKQLIVGVNKMDSLNHHTV 528
              LG+++ IV ++K D ++   +
Sbjct: 95  LGFLGIEKGIVVISKADRVDEEFI 118


>UniRef50_Q74NG5 Cluster: NEQ270; n=1; Nanoarchaeum equitans|Rep:
           NEQ270 - Nanoarchaeum equitans
          Length = 396

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 28/70 (40%), Positives = 39/70 (55%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           ++++DAPGH   I  M++G +  D AVL+VAA  G          QT EH   A  +G+K
Sbjct: 79  ISLVDAPGHESLIMVMLSGAALVDAAVLVVAANEGIMP-------QTIEHLKAAEIMGIK 131

Query: 478 QLIVGVNKMD 507
             IV  NK+D
Sbjct: 132 HFIVAQNKID 141


>UniRef50_Q1MPY9 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Lawsonia intracellularis
           PHE/MN1-00|Rep: Selenocysteine-specific translation
           elongation factor - Lawsonia intracellularis (strain
           PHE/MN1-00)
          Length = 641

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 27/70 (38%), Positives = 38/70 (54%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           ++IID PGH  FIKNM+ G S  D  +L++AA  G          QT+EH  +   LG+K
Sbjct: 55  LSIIDVPGHEKFIKNMVAGASGIDVVMLVIAADEGVMP-------QTKEHIEICSLLGIK 107

Query: 478 QLIVGVNKMD 507
              + + K D
Sbjct: 108 HGFIVLTKTD 117


>UniRef50_A7ANX2 Cluster: Elongation factor Tu GTP binding domain
           containing protein; n=1; Babesia bovis|Rep: Elongation
           factor Tu GTP binding domain containing protein -
           Babesia bovis
          Length = 601

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 36/117 (30%), Positives = 59/117 (50%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           +  ID PGH D I N++ G S A  A+++V       E    K G   +H  + + LGV+
Sbjct: 204 IDFIDTPGHHDLIANLVKGASFARAAIVVVDILDFLKE---DKYGYFEQHLFILWALGVR 260

Query: 478 QLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLE 648
           + I+ VNK+D L    +  +  +SR K   T    G    ++  +P SG +G N+++
Sbjct: 261 EFIICVNKVDRLEDVQMYKE-AESRVK-ELTKPFTG--STSITIIPTSGLNGINLVK 313



 Score = 40.7 bits (91), Expect = 0.048
 Identities = 17/36 (47%), Positives = 23/36 (63%)
 Frame = +3

Query: 57  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 164
           T +N+VV G VD GKST  GHL+   G +D R + +
Sbjct: 113 TSLNVVVCGRVDVGKSTLLGHLLTLLGAVDSRLLRE 148


>UniRef50_A7H0F4 Cluster: Selenocysteine-specific translation
           elongation factor; n=13; Campylobacter|Rep:
           Selenocysteine-specific translation elongation factor -
           Campylobacter curvus 525.92
          Length = 605

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 30/99 (30%), Positives = 46/99 (46%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID++    +     +  ID PGH   +K MI+G    D  +L+VAA  G          Q
Sbjct: 40  IDLSFSNLKRGDENIAFIDVPGHESLVKTMISGAFGFDACLLVVAANEGIMP-------Q 92

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSR 552
           T+EH  +   LGV  +IV + K D +    ++   R+ R
Sbjct: 93  TKEHINILSLLGVNSIIVAITKSDLVGAQELAQREREIR 131


>UniRef50_A5KED2 Cluster: Elongation factor, putative; n=1;
           Plasmodium vivax|Rep: Elongation factor, putative -
           Plasmodium vivax
          Length = 833

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 24/61 (39%), Positives = 40/61 (65%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 242
           +NI+V+GH+D+GKST  G L+Y    + ++T++K+E   +     S KY ++LD+   ER
Sbjct: 118 LNILVLGHIDAGKSTLIGALLYNLSYVSEQTVKKYEHVRE-----SSKYTFILDEEDDER 172

Query: 243 E 245
           E
Sbjct: 173 E 173



 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/74 (32%), Positives = 39/74 (52%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           V I D PGH + + N+ T +  AD A+L+V A          KN +T  +  +   +G+ 
Sbjct: 257 VNIFDTPGHNELVTNLHTWSFFADTAILVVDAN----NIYSKKNDETYRNVSILKAVGIS 312

Query: 478 QLIVGVNKMDSLNH 519
            +IV VNK+D  ++
Sbjct: 313 NVIVAVNKLDLFDY 326


>UniRef50_Q46497 Cluster: Selenocysteine-specific elongation factor;
           n=4; Desulfovibrionales|Rep: Selenocysteine-specific
           elongation factor - Desulfovibrio baculatus
           (Desulfomicrobium baculatus)
          Length = 634

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 27/75 (36%), Positives = 41/75 (54%)
 Frame = +1

Query: 283 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 462
           T +  + IID PGH  F+KNM++G +  D  +L++AA  G          QTREH  +  
Sbjct: 50  TPEVRLGIIDVPGHERFVKNMVSGAAGIDFVLLVIAADEGIMP-------QTREHLEICS 102

Query: 463 TLGVKQLIVGVNKMD 507
            LG++  +V + K D
Sbjct: 103 LLGIRAGLVALTKTD 117


>UniRef50_A6G2B2 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; Plesiocystis pacifica
           SIR-1|Rep: Translation elongation factor,
           selenocysteine-specific - Plesiocystis pacifica SIR-1
          Length = 696

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 33/126 (26%), Positives = 57/126 (45%), Gaps = 1/126 (0%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           K   +  ++ I+D PGH   ++ M+ G    D  +L+++A     E G+    QTREH  
Sbjct: 64  KKRAAPLHLGIVDVPGHEALVRTMVAGAGGMDAVLLVISA-----EDGVMP--QTREHLH 116

Query: 454 LAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVA-FVPISGWH 630
           +   LG++  +V + K+D L+  +                 +L   P A A  VP+S   
Sbjct: 117 VCELLGLRHAVVALTKIDRLDGESEDDKEELLELAREDIREQLAATPFAEAPIVPVSAHS 176

Query: 631 GDNMLE 648
           G+ + E
Sbjct: 177 GEGLEE 182


>UniRef50_A7PSI5 Cluster: Chromosome chr6 scaffold_28, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr6 scaffold_28, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 154

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 28/61 (45%), Positives = 37/61 (60%)
 Frame = -3

Query: 447 MLTGLTVLRDTSFEFTGTGSYDEHSAISLRGSCDHVLDEISVSRSINDGNIVLASFELPE 268
           MLTGLT+L +T               ISLRG+ DHVLDE+++SRSIND  +  +  +LP 
Sbjct: 75  MLTGLTILGNTKSMIR---------TISLRGTSDHVLDEVTMSRSINDSAVTFSGLKLPR 125

Query: 267 S 265
           S
Sbjct: 126 S 126


>UniRef50_A7PFT2 Cluster: Chromosome chr11 scaffold_14, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr11 scaffold_14, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 247

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 23/34 (67%), Positives = 29/34 (85%)
 Frame = +1

Query: 409 EAGISKNGQTREHALLAFTLGVKQLIVGVNKMDS 510
           +AGISK+GQTREHALLA  LGV+Q+I   NKM++
Sbjct: 90  QAGISKDGQTREHALLALILGVRQMICCCNKMEA 123


>UniRef50_Q57918 Cluster: Selenocysteine-specific elongation factor;
           n=7; Methanococcales|Rep: Selenocysteine-specific
           elongation factor - Methanococcus jannaschii
          Length = 469

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 29/91 (31%), Positives = 46/91 (50%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID+    F   +Y +T++DAPGH + I+  I   +  D A+L+V A  G          Q
Sbjct: 51  IDLGFSSFTLDRYRITLVDAPGHSELIRTAIGAGNIIDAALLVVDAKEG-------PKTQ 103

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTV 528
           T EH L+   L +  ++V +NK+D  N   +
Sbjct: 104 TGEHLLVLDLLNIPTIVV-INKIDIANDEEI 133


>UniRef50_Q67QI5 Cluster: Selenocysteine-specific elongation factor;
           n=1; Symbiobacterium thermophilum|Rep:
           Selenocysteine-specific elongation factor -
           Symbiobacterium thermophilum
          Length = 629

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 1/92 (1%)
 Frame = +1

Query: 256 IDIALWKFET-SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNG 432
           IDI   +F   S     +ID PGH  F++NM+ G +  D  +L+VAA  G          
Sbjct: 41  IDIGFARFPLPSGRRAAVIDVPGHEKFVRNMLAGITGIDLVILVVAADEGVMP------- 93

Query: 433 QTREHALLAFTLGVKQLIVGVNKMDSLNHHTV 528
           QTREH  +   L + + +V + K+D ++   V
Sbjct: 94  QTREHLDILRLLEISKGLVAITKIDLVDEEMV 125


>UniRef50_Q0ATV7 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Syntrophomonas wolfei subsp.
           wolfei str. Goettingen|Rep: Selenocysteine-specific
           translation elongation factor - Syntrophomonas wolfei
           subsp. wolfei (strain Goettingen)
          Length = 631

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 28/74 (37%), Positives = 38/74 (51%)
 Frame = +1

Query: 286 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFT 465
           S +   I+D PGH  FI++M+ G    D  V ++AA  G          QTREH  +   
Sbjct: 52  SGHKAAIVDVPGHERFIRHMLAGAFGIDMVVFVIAADEGIMP-------QTREHLDIIEL 104

Query: 466 LGVKQLIVGVNKMD 507
           LGVKQ +V + K D
Sbjct: 105 LGVKQGVVAITKKD 118


>UniRef50_A0Z3R3 Cluster: Selenocysteine-specific elongation factor;
           n=1; marine gamma proteobacterium HTCC2080|Rep:
           Selenocysteine-specific elongation factor - marine gamma
           proteobacterium HTCC2080
          Length = 641

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 29/67 (43%), Positives = 37/67 (55%)
 Frame = +1

Query: 307 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 486
           ID PGHR FI  MI+G S  D  +L+VAA  G          QT EH  +   LGV+ + 
Sbjct: 56  IDVPGHRKFINTMISGISGVDMGLLVVAADDGPMP-------QTLEHIDVLEILGVESVC 108

Query: 487 VGVNKMD 507
           V +NK+D
Sbjct: 109 VVINKID 115


>UniRef50_A7PCT1 Cluster: Chromosome chr17 scaffold_12, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr17 scaffold_12, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 304

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 27/68 (39%), Positives = 40/68 (58%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I +A  ++ET+K +   +D PGH D+ KNMITG +Q D ++ +V A  G          +
Sbjct: 209 IAMAHVEYETAKRHYAHVDCPGHADYEKNMITGAAQMDVSIQVVFAPNGPMP-------R 261

Query: 436 TREHALLA 459
           T+EH LLA
Sbjct: 262 TKEHILLA 269


>UniRef50_Q8XIK3 Cluster: Selenocysteine-specific elongation factor;
           n=8; Clostridia|Rep: Selenocysteine-specific elongation
           factor - Clostridium perfringens
          Length = 635

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 29/68 (42%), Positives = 38/68 (55%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           IID PGH  FIKNM+ G +  D  +LI+A      + GI    QT+EH  +   L VK+ 
Sbjct: 58  IIDVPGHEKFIKNMLAGATSLDVVLLIIA-----LDEGIMP--QTKEHLEILELLEVKKC 110

Query: 484 IVGVNKMD 507
           IV + K D
Sbjct: 111 IVALTKRD 118


>UniRef50_Q7VI67 Cluster: Selenocysteine-specific elongation factor
           SelB; n=2; Helicobacteraceae|Rep:
           Selenocysteine-specific elongation factor SelB -
           Helicobacter hepaticus
          Length = 632

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 28/88 (31%), Positives = 41/88 (46%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D++          V  ID PGH   +KNMI G    D  +L++AA  G          Q
Sbjct: 45  LDLSFSHLHLPSRNVAFIDVPGHNKLVKNMIAGAFGIDVLLLVIAANEGIMP-------Q 97

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNH 519
           + EH L+A  LG+   I  + K+D L +
Sbjct: 98  SIEHLLIADMLGISSCICVITKIDKLEN 125


>UniRef50_A6BIM9 Cluster: Putative uncharacterized protein; n=1;
           Dorea longicatena DSM 13814|Rep: Putative
           uncharacterized protein - Dorea longicatena DSM 13814
          Length = 637

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 26/68 (38%), Positives = 37/68 (54%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           I+D PGH  FI NM+ G    D  +L++AA  G          QTREH  +   LG+++ 
Sbjct: 58  IVDVPGHEKFINNMVAGVVGMDLVLLVIAADEGIMP-------QTREHMDILNLLGIEKS 110

Query: 484 IVGVNKMD 507
           I+ +NK D
Sbjct: 111 IIVLNKCD 118


>UniRef50_Q74GZ1 Cluster: Selenocysteine-specific translation
           elongation factor; n=7; Proteobacteria|Rep:
           Selenocysteine-specific translation elongation factor -
           Geobacter sulfurreducens
          Length = 636

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 25/71 (35%), Positives = 38/71 (53%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           I+D PGH  F++ M+ G    D  +L++AA  G          QTREH  +   LGVK+ 
Sbjct: 58  IVDVPGHERFVRTMVAGVGGMDLVMLVIAADEGVMP-------QTREHLEICQLLGVKKG 110

Query: 484 IVGVNKMDSLN 516
           +V + K D ++
Sbjct: 111 LVALTKSDMVD 121


>UniRef50_Q2LU53 Cluster: Selenocysteine-specific protein
           translation Elongation Factor; n=1; Syntrophus
           aciditrophicus SB|Rep: Selenocysteine-specific protein
           translation Elongation Factor - Syntrophus
           aciditrophicus (strain SB)
          Length = 636

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/68 (32%), Positives = 38/68 (55%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           ++D PGH  F+KNM+ G +  D  ++++AA  G          QTREH  +   L +++ 
Sbjct: 58  VVDVPGHERFVKNMVAGAAGIDMVLMVIAADEGVMP-------QTREHLQICSLLNIRKG 110

Query: 484 IVGVNKMD 507
           +V + K+D
Sbjct: 111 LVALTKID 118


>UniRef50_Q3E0L1 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=1; Chloroflexus aurantiacus J-10-fl|Rep:
           Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain - Chloroflexus aurantiacus J-10-fl
          Length = 622

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 28/70 (40%), Positives = 41/70 (58%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           V++ID PGH  FIKNM+ G    D  +L++AA     EA +    QTREH  +   L ++
Sbjct: 60  VSLIDVPGHERFIKNMLAGVGGIDAVLLVIAAD----EAVMP---QTREHLAIIDLLAIR 112

Query: 478 QLIVGVNKMD 507
             IV ++K+D
Sbjct: 113 HGIVVLSKVD 122


>UniRef50_A6P2V2 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 629

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 27/71 (38%), Positives = 39/71 (54%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +  ++D PGH  FI+NM++G + A   +L V AG G          QTREH  L   LG+
Sbjct: 55  WADLVDVPGHEKFIRNMLSGAAGAGGVLLTVDAGKGIMP-------QTREHLALCALLGM 107

Query: 475 KQLIVGVNKMD 507
           ++ IV + K D
Sbjct: 108 ERGIVALTKAD 118


>UniRef50_Q7R7M3 Cluster: Elongation factor Tu family, putative;
           n=6; Plasmodium|Rep: Elongation factor Tu family,
           putative - Plasmodium yoelii yoelii
          Length = 597

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 1/89 (1%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           V I D PGH + + N+ T +  ADCA+L+V A          KN +T  +  +   +G+ 
Sbjct: 226 VNIFDTPGHNELVNNLHTCSFFADCAILVVDAN----NVYNKKNDETYRNVCILKYVGIS 281

Query: 478 QLIVGVNKMDSLNH-HTVSPDLRKSRRKY 561
            +I+ +NK+D  ++   +  D+ K+ + Y
Sbjct: 282 NIIIVINKIDLFDYDENIFNDICKTIKTY 310



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/61 (37%), Positives = 39/61 (63%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 242
           +NI+V+GH+D+GKST  G L+Y    ++ + ++K+E   +     S KY ++LD+   ER
Sbjct: 107 LNILVLGHIDAGKSTLIGALLYNLNYVNDQMLKKYENIRE-----SSKYTYILDEEGDER 161

Query: 243 E 245
           E
Sbjct: 162 E 162


>UniRef50_A0BK03 Cluster: Chromosome undetermined scaffold_111,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_111,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 446

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 37/135 (27%), Positives = 58/135 (42%), Gaps = 1/135 (0%)
 Frame = +1

Query: 277 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL- 453
           F  S    T+I+ PG   +I  M  G +  + AV +++ G  E      K   T E  L 
Sbjct: 80  FTISNKKYTLINIPGQYQYINQMQLGIAYGEIAVFVLS-GVKEKYVQDFKGQSTLELQLR 138

Query: 454 LAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHG 633
           L   LG K +I  +N MD + +     +   +   +     +   NP  ++FVPIS    
Sbjct: 139 LWMALGKKHIICAINDMDLVEYQQDCYEYVVN--DFSQRLAKFEINPKQISFVPISLIDA 196

Query: 634 DNMLEPSTKMPWFKG 678
           +N+      M W+KG
Sbjct: 197 ENINTKKQHMDWYKG 211



 Score = 35.1 bits (77), Expect = 2.4
 Identities = 14/59 (23%), Positives = 32/59 (54%)
 Frame = +3

Query: 69  IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           +V++G    GKST  G ++ +   +    + + ++  Q       +YA+++D+L+ ER+
Sbjct: 10  VVLLGAHGQGKSTVAGLIVNELNYVSPYALVRIDEHPQVQENPHLRYAFLMDRLRTERK 68


>UniRef50_A7QN79 Cluster: Chromosome undetermined scaffold_131,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_131, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 355

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 21/59 (35%), Positives = 36/59 (61%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNG 432
           +++    FE      TI+DA GH++++ NMI+G SQ D  +L++ A   +FE G  ++G
Sbjct: 66  VEVGRAHFEPETTRFTILDAWGHKNYVPNMISGASQVDIGMLVIYAQKVKFETGGERSG 124


>UniRef50_Q1Z854 Cluster: Hypothetical selenocysteine-specific
           translation elongation factor; n=4; Vibrionaceae|Rep:
           Hypothetical selenocysteine-specific translation
           elongation factor - Photobacterium profundum 3TCK
          Length = 616

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 22/78 (28%), Positives = 42/78 (53%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           + +ID PGH  +++NM+ G    +  +L+VAA  G           T  H  +A  +G++
Sbjct: 64  IGVIDVPGHERYLRNMVAGVWHLNALILVVAADEGWMP-------MTTSHVQVAHAMGIE 116

Query: 478 QLIVGVNKMDSLNHHTVS 531
           ++I+ +NK D ++   +S
Sbjct: 117 EIILCINKRDKVSPERLS 134


>UniRef50_A0YH51 Cluster: Selenocysteine-specific elongation factor;
           n=1; marine gamma proteobacterium HTCC2143|Rep:
           Selenocysteine-specific elongation factor - marine gamma
           proteobacterium HTCC2143
          Length = 642

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/73 (35%), Positives = 38/73 (52%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           V  ID PGH+ FI NM+TG +  D A+L++AA  G          QT EH      +G+ 
Sbjct: 52  VGFIDVPGHQKFIANMLTGIAALDLALLVIAADDGPMP-------QTYEHLAALNLMGLT 104

Query: 478 QLIVGVNKMDSLN 516
           +  + + K D +N
Sbjct: 105 RAAIVITKTDRVN 117


>UniRef50_A0LHL0 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Syntrophobacter fumaroxidans
           MPOB|Rep: Selenocysteine-specific translation elongation
           factor - Syntrophobacter fumaroxidans (strain DSM 10017
           / MPOB)
          Length = 642

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/68 (38%), Positives = 37/68 (54%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           I+D PGH  F+K+M+ G +  D   L++AA  G          QTREH  +   L VKQ 
Sbjct: 58  IVDVPGHERFVKHMVAGATGIDLVALVIAADEGVMP-------QTREHMEICELLRVKQG 110

Query: 484 IVGVNKMD 507
           +V + K+D
Sbjct: 111 LVVLTKID 118


>UniRef50_Q47F25 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; Dechloromonas aromatica
           RCB|Rep: Translation elongation factor,
           selenocysteine-specific - Dechloromonas aromatica
           (strain RCB)
          Length = 627

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 26/68 (38%), Positives = 37/68 (54%)
 Frame = +1

Query: 307 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 486
           ID PGH   I NM+ G +  D A+L++AA  G          QTREH  +   LG+K+  
Sbjct: 51  IDVPGHEKLIHNMLAGATGIDFALLVIAADDGPMP-------QTREHLEIIELLGIKRGA 103

Query: 487 VGVNKMDS 510
           V + K+D+
Sbjct: 104 VALTKIDN 111


>UniRef50_Q8TVI5 Cluster: Translation elongation factor, GTPase;
           n=1; Methanopyrus kandleri|Rep: Translation elongation
           factor, GTPase - Methanopyrus kandleri
          Length = 358

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 28/70 (40%), Positives = 40/70 (57%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           V+ +D PGHRD+I+NM+     AD A+L+VAA  G           T +HAL+    G +
Sbjct: 63  VSFVDVPGHRDYIRNMLASAWSADYAILVVAADEGPCPG-------TIDHALVVSFYGAR 115

Query: 478 QLIVGVNKMD 507
            L V V+K+D
Sbjct: 116 VLPV-VSKVD 124


>UniRef50_Q0BZB1 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Hyphomonas neptunium ATCC
           15444|Rep: Selenocysteine-specific translation
           elongation factor - Hyphomonas neptunium (strain ATCC
           15444)
          Length = 623

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 28/70 (40%), Positives = 42/70 (60%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           + ++DAPGH++FI+ M+ G + A  A L+V+A  G  EA      QT EH  +  TLG+ 
Sbjct: 55  IDLVDAPGHQNFIRAMVGGAAGARSAALVVSAAEG-VEA------QTLEHIAVIETLGIH 107

Query: 478 QLIVGVNKMD 507
             IV ++K D
Sbjct: 108 AGIVVLSKAD 117


>UniRef50_A1FN34 Cluster: Selenocysteine-specific translation
           elongation factor; n=7; Pseudomonas|Rep:
           Selenocysteine-specific translation elongation factor -
           Pseudomonas putida W619
          Length = 640

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 26/67 (38%), Positives = 34/67 (50%)
 Frame = +1

Query: 307 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 486
           ID PGH  FI NM+ G    D  +L+VAA  G          QTREH  +   LG+   +
Sbjct: 57  IDVPGHERFIHNMLAGAHGIDLVLLVVAADDGVMP-------QTREHLAIIELLGIPLAL 109

Query: 487 VGVNKMD 507
           V ++K D
Sbjct: 110 VAISKCD 116


>UniRef50_Q8TJT7 Cluster: Translation initiation factor 2 subunit
           gamma; n=48; Archaea|Rep: Translation initiation factor
           2 subunit gamma - Methanosarcina acetivorans
          Length = 443

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 23/70 (32%), Positives = 39/70 (55%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           V+ +DAPGH   +  M++G +  D AVL++AA             QT+EH +    +G+K
Sbjct: 118 VSFVDAPGHETLMATMLSGAAIMDGAVLVIAANEE------CPQPQTKEHLMALDIIGIK 171

Query: 478 QLIVGVNKMD 507
            +++  NK+D
Sbjct: 172 NIVIVQNKID 181


>UniRef50_Q30SC0 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; Thiomicrospira
           denitrificans ATCC 33889|Rep: Translation elongation
           factor, selenocysteine-specific - Thiomicrospira
           denitrificans (strain ATCC 33889 / DSM 1351)
          Length = 611

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 27/92 (29%), Positives = 42/92 (45%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID++          +  ID PGH   +KNMI G    DC +++V+   G          Q
Sbjct: 41  IDLSFSNITKDGKNIAFIDVPGHEKLVKNMIAGAFSFDCVLIVVSVIDG-------IKPQ 93

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVS 531
           T EH  +   LGVK  ++ V K D ++   ++
Sbjct: 94  TIEHLEILNLLGVKNAVLVVTKKDLVDERELA 125


>UniRef50_A0YGX4 Cluster: Translation elongation factor,
           selenocysteine-specific; n=1; marine gamma
           proteobacterium HTCC2143|Rep: Translation elongation
           factor, selenocysteine-specific - marine gamma
           proteobacterium HTCC2143
          Length = 627

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 27/73 (36%), Positives = 38/73 (52%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           +  ID PGH  FI +MI G    D A+L+VAA  G          QT EH  +   LG +
Sbjct: 53  IGFIDVPGHTRFINSMIAGVGGIDMAMLVVAADDGVMP-------QTTEHLDVLRLLGQQ 105

Query: 478 QLIVGVNKMDSLN 516
           Q +V + K+D ++
Sbjct: 106 QFVVVITKIDRVD 118


>UniRef50_A0KL71 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Aeromonas|Rep:
           Selenocysteine-specific translation elongation factor -
           Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966
           / NCIB 9240)
          Length = 627

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           + +ID PGH  +I+NM+ G    D  +L++AA  G           T +H  L   +GV 
Sbjct: 57  IGVIDVPGHERYIRNMVAGLWSLDLVLLVIAADEGWMP-------MTGDHLRLLKAMGVP 109

Query: 478 QLIVGVNKMD 507
           +L+V +NK D
Sbjct: 110 RLLVCINKCD 119


>UniRef50_A4YIX9 Cluster: Protein synthesis factor, GTP-binding;
           n=1; Metallosphaera sedula DSM 5348|Rep: Protein
           synthesis factor, GTP-binding - Metallosphaera sedula
           DSM 5348
          Length = 415

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 26/70 (37%), Positives = 39/70 (55%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           V+ +DAPGH   +  M++GT+  D A+L+VAA             QTREH +     G+ 
Sbjct: 89  VSFVDAPGHEVLMATMLSGTAILDGAILVVAANEP------FPQPQTREHFVALGIAGIN 142

Query: 478 QLIVGVNKMD 507
           +LI+  NK+D
Sbjct: 143 KLIIVQNKVD 152


>UniRef50_P55972 Cluster: Translation initiation factor IF-2; n=5;
           Helicobacteraceae|Rep: Translation initiation factor
           IF-2 - Helicobacter pylori (Campylobacter pylori)
          Length = 944

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 44/136 (32%), Positives = 61/136 (44%), Gaps = 7/136 (5%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  +  E +  +V+ ID PGH  F +    G    D AV+++AA  G  +  I    +  
Sbjct: 482 IGAYMVEKNDKWVSFIDTPGHEAFSQMRNRGAQVTDIAVIVIAADDGVKQQTI----EAL 537

Query: 442 EHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNP----AAVAF 609
           EHA  A       +I  +NKMD  N   V+PD  K+          LGYNP        F
Sbjct: 538 EHAKAANV----PVIFAMNKMDKPN---VNPDKLKAE------CAELGYNPVDWGGEHEF 584

Query: 610 VPISGWHG---DNMLE 648
           +P+S   G   DN+LE
Sbjct: 585 IPVSAKTGDGIDNLLE 600


>UniRef50_Q1NKM4 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=3; Deltaproteobacteria|Rep: Translation
           elongation factor, selenocysteine-specific:Small GTP-
           binding protein domain - delta proteobacterium MLMS-1
          Length = 639

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           I+D PGH  F++NM+ G +  D    +VAA  G          QTREH  +   LG+++ 
Sbjct: 58  IVDVPGHERFVRNMVAGAAGIDLVAFVVAADEGIMP-------QTREHFEICRLLGIQRG 110

Query: 484 IVGVNKMD 507
           ++ + K D
Sbjct: 111 LIVITKRD 118


>UniRef50_Q18YZ1 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Desulfitobacterium
           hafniense|Rep: Selenocysteine-specific translation
           elongation factor - Desulfitobacterium hafniense (strain
           DCB-2)
          Length = 634

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 25/70 (35%), Positives = 36/70 (51%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           V+IID PGH  F+K M+ G +  D  +L++AA  G          QTREH  +   L V 
Sbjct: 56  VSIIDVPGHEKFVKTMVAGVTGIDLVMLVIAADEGIMP-------QTREHLDILNLLNVT 108

Query: 478 QLIVGVNKMD 507
             ++ + K D
Sbjct: 109 TGVIALTKTD 118


>UniRef50_A7HHY2 Cluster: Selenocysteine-specific translation
           elongation factor precursor; n=5; Cystobacterineae|Rep:
           Selenocysteine-specific translation elongation factor
           precursor - Anaeromyxobacter sp. Fw109-5
          Length = 649

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 26/70 (37%), Positives = 35/70 (50%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           ++D PGH  F++ M  G    D  VL++AA  G          QTREH  +   LGV + 
Sbjct: 58  VVDVPGHERFVRAMAAGAGGIDLVVLVIAADEGVMP-------QTREHLDICRLLGVPRG 110

Query: 484 IVGVNKMDSL 513
           +V V K D L
Sbjct: 111 LVAVTKSDLL 120


>UniRef50_O36041 Cluster: Eukaryotic translation initiation factor 2
           subunit gamma; n=1; Spironucleus vortens|Rep: Eukaryotic
           translation initiation factor 2 subunit gamma -
           Spironucleus vortens
          Length = 210

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = +1

Query: 295 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 474
           +++IID PGH D++  M++G +  D  +L+++A     E    +  QTREH       G 
Sbjct: 80  HISIIDCPGHHDYMTTMLSGVAAMDGTLLLISA-----EQRCPQE-QTREHFQAIQATGQ 133

Query: 475 KQLIVGVNKMD 507
           K++I+  NK+D
Sbjct: 134 KKIIIAQNKID 144


>UniRef50_Q1ZC67 Cluster: Selenocysteine synthase; n=1; Psychromonas
           sp. CNPT3|Rep: Selenocysteine synthase - Psychromonas
           sp. CNPT3
          Length = 523

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/70 (30%), Positives = 38/70 (54%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           + I+D PGH  +I+NM++G +  +  +L+++A  G           T +H  +A  LG  
Sbjct: 62  IGIVDVPGHERYIRNMVSGIANLNAVILVISATEGWMP-------MTTDHVQIAQALGQT 114

Query: 478 QLIVGVNKMD 507
            +I+ +NK D
Sbjct: 115 NIIICINKSD 124


>UniRef50_A7Q762 Cluster: Chromosome chr5 scaffold_58, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_58, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 177

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 17/38 (44%), Positives = 28/38 (73%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 387
           ++ET+K +   +D PGH D++KNMITG +Q D ++ +V
Sbjct: 111 EYETAKRHCDHVDCPGHADYVKNMITGAAQMDGSIQVV 148


>UniRef50_Q46455 Cluster: Selenocysteine-specific elongation factor;
           n=5; Clostridia|Rep: Selenocysteine-specific elongation
           factor - Moorella thermoacetica (Clostridium
           thermoaceticum)
          Length = 634

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 24/68 (35%), Positives = 36/68 (52%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           ++D PGH  FI+ M+ G    D  +L+VAA  G          QTREH  +   L +K+ 
Sbjct: 58  LVDVPGHERFIRQMLAGVGGMDLVMLVVAADEGVMP-------QTREHLAIIDLLQIKKG 110

Query: 484 IVGVNKMD 507
           I+ + K+D
Sbjct: 111 IIVITKID 118


>UniRef50_Q1IHM2 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Acidobacteria|Rep:
           Selenocysteine-specific translation elongation factor -
           Acidobacteria bacterium (strain Ellin345)
          Length = 628

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 26/80 (32%), Positives = 42/80 (52%)
 Frame = +1

Query: 289 KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTL 468
           K  +  +D PGH  FI+NM+ G    D  +LI++A     E  I    QTREH  +   L
Sbjct: 57  KLRIGFVDVPGHERFIRNMLAGVGGIDLVMLIISA-----EESIKP--QTREHFDICRML 109

Query: 469 GVKQLIVGVNKMDSLNHHTV 528
           G+++ +  + K D ++  T+
Sbjct: 110 GIERGLTVLTKSDLVDEETL 129


>UniRef50_Q1ETS8 Cluster: Translation elongation factor,
           selenocysteine-specific:Small GTP- binding protein
           domain; n=6; Clostridiales|Rep: Translation elongation
           factor, selenocysteine-specific:Small GTP- binding
           protein domain - Clostridium oremlandii OhILAs
          Length = 631

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 25/66 (37%), Positives = 36/66 (54%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           IID PGH  FI+NM+ G S  D  +L+VAA  G          QT+EH  +   L +++ 
Sbjct: 58  IIDVPGHEKFIRNMLAGVSGMDIVLLVVAADEGVMP-------QTKEHLDILSLLKIEKG 110

Query: 484 IVGVNK 501
           I+ + K
Sbjct: 111 IIVITK 116


>UniRef50_P43927 Cluster: Selenocysteine-specific elongation factor;
           n=21; Pasteurellaceae|Rep: Selenocysteine-specific
           elongation factor - Haemophilus influenzae
          Length = 619

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 27/85 (31%), Positives = 43/85 (50%)
 Frame = +1

Query: 307 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 486
           ID PGH  F+ NM+ G      A+LIVAA     + G++   QT+EH  +   L   ++I
Sbjct: 55  IDVPGHEKFLSNMLAGLGGVHYAMLIVAA-----DEGVAV--QTKEHLAILRQLQFHEII 107

Query: 487 VGVNKMDSLNHHTVSPDLRKSRRKY 561
           V + K D  N   +   ++  ++ Y
Sbjct: 108 VVITKADRTNSAQIESLIQTIKQDY 132


>UniRef50_Q4S9H1 Cluster: Chromosome undetermined SCAF14696, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF14696,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 395

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 30/78 (38%), Positives = 43/78 (55%)
 Frame = +1

Query: 280 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 459
           E+ +YY T  D P H D+IK         D  +L+VAA  G+         QTREH LLA
Sbjct: 76  ESRRYYHT--DCPAHADYIK--------MDGCILVVAATGGQMP-------QTREHLLLA 118

Query: 460 FTLGVKQLIVGVNKMDSL 513
             +GV+ ++V +NK D++
Sbjct: 119 RQIGVEHVVVFINKADAV 136


>UniRef50_A4E707 Cluster: Putative uncharacterized protein; n=1;
           Collinsella aerofaciens ATCC 25986|Rep: Putative
           uncharacterized protein - Collinsella aerofaciens ATCC
           25986
          Length = 655

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           V ++D PGH  +++ M+ G +  D AVL+V+A  G          QTREH  +   LGV 
Sbjct: 64  VGLVDVPGHSHYLRAMVQGATGIDVAVLVVSAVEGVMP-------QTREHVHVLELLGVT 116

Query: 478 QLIVGVNKMD 507
            ++V +   D
Sbjct: 117 HMVVALTMCD 126


>UniRef50_Q931D5 Cluster: SelB selenocysteine-specific elongation
           factor; n=4; Alphaproteobacteria|Rep: SelB
           selenocysteine-specific elongation factor - Rhizobium
           meliloti (Sinorhizobium meliloti)
          Length = 666

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 31/85 (36%), Positives = 42/85 (49%), Gaps = 1/85 (1%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVT-IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNG 432
           ID+       +K  VT  +D PGH  FI  M+ G    D A+L+VAA     + GI    
Sbjct: 38  IDLGFAYARFAKDAVTGFVDVPGHERFIHTMLAGAGGIDYAMLVVAA-----DDGIKP-- 90

Query: 433 QTREHALLAFTLGVKQLIVGVNKMD 507
           QT EH  +   LGV + +V + K D
Sbjct: 91  QTLEHLAILDLLGVSRGLVAITKAD 115


>UniRef50_Q73LA2 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Treponema denticola|Rep:
           Selenocysteine-specific translation elongation factor -
           Treponema denticola
          Length = 590

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           V I+D PGH  FI+NM+ GT   D A+LIVAA  G
Sbjct: 55  VGIVDVPGHERFIRNMVAGTWGLDAALLIVAADDG 89


>UniRef50_O67141 Cluster: Elongation factor SelB; n=1; Aquifex
           aeolicus|Rep: Elongation factor SelB - Aquifex aeolicus
          Length = 582

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 27/71 (38%), Positives = 35/71 (49%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           IID PGH  FIKN I G   A   +L+V    G          QT EH  +A + G+K  
Sbjct: 59  IIDVPGHERFIKNAIAGICSASGLILVVDPNEGIMP-------QTIEHLRVAKSFGIKHG 111

Query: 484 IVGVNKMDSLN 516
           I  + KMD ++
Sbjct: 112 IAVLTKMDKVD 122


>UniRef50_P14081 Cluster: Selenocysteine-specific elongation factor;
           n=33; Enterobacteriaceae|Rep: Selenocysteine-specific
           elongation factor - Escherichia coli (strain K12)
          Length = 614

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 26/74 (35%), Positives = 34/74 (45%)
 Frame = +1

Query: 307 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 486
           ID PGH  F+ NM+ G    D A+L+VA   G          QTREH  +    G   L 
Sbjct: 56  IDVPGHEKFLSNMLAGVGGIDHALLVVACDDGVM-------AQTREHLAILQLTGNPMLT 108

Query: 487 VGVNKMDSLNHHTV 528
           V + K D ++   V
Sbjct: 109 VALTKADRVDEARV 122


>UniRef50_Q0LF89 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Herpetosiphon aurantiacus ATCC
           23779|Rep: Selenocysteine-specific translation
           elongation factor - Herpetosiphon aurantiacus ATCC 23779
          Length = 627

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = +1

Query: 271 WKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHA 450
           W    + + V ++D PGH   IKNM+ G +  D  + +VAA  G          Q+ EH 
Sbjct: 46  WFSTPAGHSVNLVDVPGHERLIKNMLAGVTGFDGVLFVVAADEG-------MQPQSHEHL 98

Query: 451 LLAFTLGVKQLIVGVNKMD 507
            +   LG++  ++ ++K+D
Sbjct: 99  QILNQLGIEHGLIIISKID 117


>UniRef50_A6DB59 Cluster: Putative selenocysteine-specific
           elongation factor; n=1; Caminibacter mediatlanticus
           TB-2|Rep: Putative selenocysteine-specific elongation
           factor - Caminibacter mediatlanticus TB-2
          Length = 607

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 34/101 (33%), Positives = 47/101 (46%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           ID++    +     V  ID PGH   +KNMI+G    D    + A  T E   GI    Q
Sbjct: 41  IDLSFTNMKKGDVNVAFIDVPGHEKLVKNMISGAFGFDAT--LFAIDTNE---GIMP--Q 93

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRK 558
           T EH  +   L VK +IV + K D       +P+L + R+K
Sbjct: 94  TIEHLEVLDILKVKNIIVALTKKD-----LATPELIEKRKK 129


>UniRef50_Q663U2 Cluster: Selenocysteine-specific elongation factor
           EF; n=11; Yersinia|Rep: Selenocysteine-specific
           elongation factor EF - Yersinia pseudotuberculosis
          Length = 657

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 25/75 (33%), Positives = 35/75 (46%)
 Frame = +1

Query: 307 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 486
           ID PGH  F+ NM+ G    D A+L+VA   G          QTREH  +    G   L 
Sbjct: 56  IDVPGHEKFLANMLAGVGGIDHALLVVACDDGVM-------AQTREHLAILRLSGRPALT 108

Query: 487 VGVNKMDSLNHHTVS 531
           V + K D ++   ++
Sbjct: 109 VALTKADRVDDERIA 123


>UniRef50_A4A194 Cluster: Small GTP-binding protein domain; n=1;
           Blastopirellula marina DSM 3645|Rep: Small GTP-binding
           protein domain - Blastopirellula marina DSM 3645
          Length = 687

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 34/89 (38%), Positives = 45/89 (50%)
 Frame = +1

Query: 250 YQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKN 429
           Y ++ AL  F         IDAPG+ DFI   I+    AD AV+++ A      AGI+ N
Sbjct: 47  YSVEAALAHFRHRGVRFNCIDAPGYPDFIGQTISAIRGADTAVIVIDA-----HAGIAVN 101

Query: 430 GQTREHALLAFTLGVKQLIVGVNKMDSLN 516
             TR     A   G+ ++IV VNKMD  N
Sbjct: 102 --TRRVFAEAQRAGLGRIIV-VNKMDLEN 127


>UniRef50_Q0HP29 Cluster: Selenocysteine-specific translation
           elongation factor; n=7; Shewanella|Rep:
           Selenocysteine-specific translation elongation factor -
           Shewanella sp. (strain MR-4)
          Length = 673

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 25/78 (32%), Positives = 37/78 (47%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           +  ID PGH  FI NM+ G S    A+L++A   G          QTREH  +   L + 
Sbjct: 53  LAFIDVPGHEKFINNMLVGVSHVRHALLVLACDDGVMP-------QTREHLQILALLPLN 105

Query: 478 QLIVGVNKMDSLNHHTVS 531
            L + + K D ++  T +
Sbjct: 106 SLTLVLTKRDLVDDQTAA 123


>UniRef50_Q9VAV2 Cluster: CG12413-PA; n=7; Endopterygota|Rep:
           CG12413-PA - Drosophila melanogaster (Fruit fly)
          Length = 696

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 38/115 (33%), Positives = 51/115 (44%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           VT +D PGH  F      G    D  VL+VAA     E G+    QTRE   LA    V 
Sbjct: 212 VTFLDTPGHAAFSAMRARGAVATDIIVLVVAA-----EDGVM--AQTREVIQLAKEAQV- 263

Query: 478 QLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNM 642
            +IV +NK+D         ++ KS+R+       L  +   V  +PIS   G N+
Sbjct: 264 PIIVALNKIDK-----PEANIEKSKRELAQMGLALEEHGGDVQVIPISALKGTNL 313


>UniRef50_Q5QTY8 Cluster: Translation initiation factor IF-2; n=104;
           Gammaproteobacteria|Rep: Translation initiation factor
           IF-2 - Idiomarina loihiensis
          Length = 896

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 29/82 (35%), Positives = 36/82 (43%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  +  ET    VT +D PGH  F      G    D  +L+VAA  G          QT+
Sbjct: 435 IGAYHVETGHGMVTFLDTPGHAAFTSMRARGAGATDVVILVVAADDGVMP-------QTK 487

Query: 442 EHALLAFTLGVKQLIVGVNKMD 507
           E    A   GV  L+V +NKMD
Sbjct: 488 EAVQHAKAAGV-PLVVAINKMD 508


>UniRef50_Q7VHF6 Cluster: Translation initiation factor IF-2; n=12;
           Campylobacterales|Rep: Translation initiation factor
           IF-2 - Helicobacter hepaticus
          Length = 882

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 39/133 (29%), Positives = 59/133 (44%), Gaps = 4/133 (3%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  +  E +   ++ ID PGH  F +    G    D A++++AA  G  +  I    +  
Sbjct: 420 IGAYMVEKNGKKISFIDTPGHEAFTQMRSRGAQVTDIAIIVIAADDGVKQQTI----EAL 475

Query: 442 EHALLAFTLGVKQLIVGVNKMDSLNHHTVSPD-LRKSRRKYPHTSRRLGYNPAAVAFVPI 618
            HA  A      Q+I+ +NKMD  N    +PD L+    +   T    G       F+PI
Sbjct: 476 NHAKAANV----QIIIAMNKMDKEN---ANPDKLKAECAEIGFTPNEWG---GEYEFIPI 525

Query: 619 SGWHGD---NMLE 648
           S  +GD   N+LE
Sbjct: 526 SAKNGDGVENLLE 538


>UniRef50_A0X1J6 Cluster: Selenocysteine-specific translation
           elongation factor; n=1; Shewanella pealeana ATCC
           700345|Rep: Selenocysteine-specific translation
           elongation factor - Shewanella pealeana ATCC 700345
          Length = 635

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 25/73 (34%), Positives = 36/73 (49%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           +  +D PGH  FI  M+ G S A  A+LI+A   G          QT EH  +   L ++
Sbjct: 53  LAFVDVPGHSKFINTMLAGVSCAKHALLIIACDDGVMP-------QTYEHLAILQLLNLE 105

Query: 478 QLIVGVNKMDSLN 516
            LIV + K D ++
Sbjct: 106 HLIVVLTKQDKVD 118


>UniRef50_Q4QHR6 Cluster: Translation initiation factor eif-2b gamma
           subunit, putative; n=4; Leishmania|Rep: Translation
           initiation factor eif-2b gamma subunit, putative -
           Leishmania major
          Length = 601

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 26/75 (34%), Positives = 37/75 (49%)
 Frame = +1

Query: 283 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 462
           T K + + +D PGH   +  M+ G +  D A+L++AA             QT EH   A 
Sbjct: 129 TLKRHFSFVDCPGHDVLMATMLNGAAIMDAALLLIAANES------FPQPQTLEHLAAAE 182

Query: 463 TLGVKQLIVGVNKMD 507
            +GV  LIV  NK+D
Sbjct: 183 MIGVLSLIVLQNKVD 197


>UniRef50_O62108 Cluster: Putative uncharacterized protein selb-1;
           n=3; Caenorhabditis|Rep: Putative uncharacterized
           protein selb-1 - Caenorhabditis elegans
          Length = 500

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 26/86 (30%), Positives = 44/86 (51%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           + +ID PGH   I+ ++  ++  D A++I+     +  AGI    QT EH LLA      
Sbjct: 74  LALIDCPGHSGLIRAVLAASTVFDMAIVII-----DVVAGIQP--QTAEHLLLASKFCPN 126

Query: 478 QLIVGVNKMDSLNHHTVSPDLRKSRR 555
           ++I+ +NK D      +S   +K R+
Sbjct: 127 RVIIVLNKCDLAEKSKISESAKKVRK 152


>UniRef50_UPI00004996CE Cluster: 116 kda u5 small nuclear
           ribonucleoprotein component; n=4; Entamoeba histolytica
           HM-1:IMSS|Rep: 116 kda u5 small nuclear
           ribonucleoprotein component - Entamoeba histolytica
           HM-1:IMSS
          Length = 941

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +1

Query: 232 RLSVXRYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           ++S+   QI + +   +   Y   IID PGH DFI  +I G S AD  ++ +    G
Sbjct: 166 KISIKSSQISLCIPSKKNGYYLCNIIDTPGHSDFIDEVIVGLSLADNVIITIDCAEG 222


>UniRef50_Q8ZZV4 Cluster: Translation initiation factor aIF-2 gamma
           subunit, putative; n=5; Thermoproteaceae|Rep:
           Translation initiation factor aIF-2 gamma subunit,
           putative - Pyrobaculum aerophilum
          Length = 411

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 21/70 (30%), Positives = 38/70 (54%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           ++++D PGH   +  M++G +  D A+L+V A         +   QT EH  +   +GV+
Sbjct: 85  ISLLDVPGHEVLVATMVSGAAVVDGALLVVDASQP------APQPQTVEHFAVLDIIGVR 138

Query: 478 QLIVGVNKMD 507
            ++V  NK+D
Sbjct: 139 HMVVAQNKID 148


>UniRef50_Q8EWU0 Cluster: Translation initiation factor IF-2; n=2;
           Mycoplasmataceae|Rep: Translation initiation factor IF-2
           - Mycoplasma penetrans
          Length = 620

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 28/82 (34%), Positives = 38/82 (46%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  ++ E  K+ +T  D PGH  F K    G    D  VL+VAA  G       +  +  
Sbjct: 165 IGAYQVEWKKHLITFFDTPGHEAFSKMRAVGADLTDIVVLVVAADDGL----KPQTEEAI 220

Query: 442 EHALLAFTLGVKQLIVGVNKMD 507
           +HAL A       +IV +NKMD
Sbjct: 221 DHALFA----KAPIIVFINKMD 238


>UniRef50_Q7WHG2 Cluster: Translation initiation factor IF-2; n=225;
           Proteobacteria|Rep: Translation initiation factor IF-2 -
           Bordetella bronchiseptica (Alcaligenes bronchisepticus)
          Length = 997

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 29/82 (35%), Positives = 37/82 (45%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  +  ET +  VT +D PGH  F      G    D  +L+VAA  G          QTR
Sbjct: 537 IGAYHVETGRGVVTFLDTPGHEAFTAMRARGAKATDIVILVVAADDGVMP-------QTR 589

Query: 442 EHALLAFTLGVKQLIVGVNKMD 507
           E A+     G   L+V VNK+D
Sbjct: 590 E-AIHHAKAGGVPLVVAVNKID 610


>UniRef50_UPI0000DB7182 Cluster: PREDICTED: similar to elongation
           factor Tu GTP binding domain containing 1; n=2;
           Apocrita|Rep: PREDICTED: similar to elongation factor Tu
           GTP binding domain containing 1 - Apis mellifera
          Length = 1065

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 23/80 (28%), Positives = 44/80 (55%)
 Frame = +1

Query: 274 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 453
           K+   ++ + +ID+PGH DF   + T     D A++++     +   G+    QTR    
Sbjct: 80  KYNCQEFAINLIDSPGHVDFASEVSTAVRLCDGAIIVI-----DVVEGVCP--QTRSALS 132

Query: 454 LAFTLGVKQLIVGVNKMDSL 513
           +++T G+K ++V +NK+D L
Sbjct: 133 ISYTEGLKPILV-LNKIDRL 151


>UniRef50_A7QC01 Cluster: Chromosome chr10 scaffold_76, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr10 scaffold_76, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 112

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 17/46 (36%), Positives = 29/46 (63%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 393
           +++    FE      TI+DA GH++ + NMI+  SQAD  +L+++A
Sbjct: 58  VEVGRAHFEPEMTRFTILDASGHKNHVPNMISSASQADMGMLVISA 103


>UniRef50_Q30SS6 Cluster: Initiation factor 2; n=1; Thiomicrospira
           denitrificans ATCC 33889|Rep: Initiation factor 2 -
           Thiomicrospira denitrificans (strain ATCC 33889 / DSM
           1351)
          Length = 874

 Score = 41.5 bits (93), Expect = 0.027
 Identities = 43/136 (31%), Positives = 59/136 (43%), Gaps = 7/136 (5%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  +  E +   +T +D PGH  F +    GT   D  +++VAA  G          QT 
Sbjct: 413 IGAYTIEQNGKAITFLDTPGHAAFSQMRQRGTDVTDIIIIVVAADDG-------VKPQTE 465

Query: 442 EHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNP----AAVAF 609
           E   LA    V  +IV VNKMD     T +PD+ K++          G NP      + F
Sbjct: 466 EVIKLAKESKV-PVIVAVNKMDK---PTANPDMVKAQ------MAERGLNPIDWGGDIEF 515

Query: 610 VPISGWHG---DNMLE 648
           +PIS   G   D +LE
Sbjct: 516 IPISAKSGMGIDELLE 531


>UniRef50_A6DBA3 Cluster: Translation initiation factor IF-2; n=1;
           Caminibacter mediatlanticus TB-2|Rep: Translation
           initiation factor IF-2 - Caminibacter mediatlanticus
           TB-2
          Length = 827

 Score = 41.5 bits (93), Expect = 0.027
 Identities = 32/97 (32%), Positives = 43/97 (44%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  +  E     +T ID PGH  F +    G    D A+++VAA  G          QTR
Sbjct: 363 IGAYMVEKDGQKITFIDTPGHEAFTEMRARGAQVTDIAIIVVAADDGVMP-------QTR 415

Query: 442 EHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSR 552
           E    A    V   I+ VNK+D  +    +PDL KS+
Sbjct: 416 EAIAHAQAANV-PFIIAVNKIDKPD---ANPDLVKSQ 448


>UniRef50_A7PNB2 Cluster: Chromosome chr1 scaffold_22, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr1 scaffold_22, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 120

 Score = 41.5 bits (93), Expect = 0.027
 Identities = 31/115 (26%), Positives = 53/115 (46%)
 Frame = +1

Query: 334 IKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSL 513
           I + +   +++D  +  + + TG FEA ISK G TR  A L   +G K+    ++   + 
Sbjct: 3   ISSSLLAKAESDSFLRGIDSTTGGFEADISKGGPTRGTAFLC-RIGHKETFCFISYPSTT 61

Query: 514 NHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 678
             H  S     S     H  R +   P   + + + G+ GDNM+E  T + + +G
Sbjct: 62  MFHIYS-QFDHSDSLAKHFLRLVESLPDPFSRLRVVGFTGDNMIERPTNLDYSRG 115


>UniRef50_Q8YQJ1 Cluster: Translation initiation factor IF-2; n=7;
           Cyanobacteria|Rep: Translation initiation factor IF-2 -
           Anabaena sp. (strain PCC 7120)
          Length = 1039

 Score = 41.5 bits (93), Expect = 0.027
 Identities = 38/135 (28%), Positives = 56/135 (41%), Gaps = 1/135 (0%)
 Frame = +1

Query: 241 VXRYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 420
           +  Y +DI     +  +  +  +D PGH  F      G    D AVL+VAA  G      
Sbjct: 572 IGAYHVDIV---HDGKEQQIVFLDTPGHEAFTAMRARGARVTDIAVLVVAADDG------ 622

Query: 421 SKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPD-LRKSRRKYPHTSRRLGYNPA 597
               QT E    A   GV  ++V +NK+D        PD +++   +Y  TS   G    
Sbjct: 623 -VRPQTVEAISHAQAAGV-PIVVAINKIDK---EGAQPDRVKQELTQYGLTSEEWG---G 674

Query: 598 AVAFVPISGWHGDNM 642
               VP+S   G+N+
Sbjct: 675 ETIMVPVSAIRGENL 689


>UniRef50_A4RX89 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 563

 Score = 41.1 bits (92), Expect = 0.036
 Identities = 31/111 (27%), Positives = 50/111 (45%)
 Frame = +1

Query: 301 TIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 480
           T++D PGH   IK ++ G S  D  +L+V A     + G+    QT E  L+   +   +
Sbjct: 77  TLVDCPGHASLIKTVLGGASIIDLMILVVDA-----QKGVQT--QTAE-CLVVGEITTDR 128

Query: 481 LIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHG 633
           LIV VNK+D+         + K + K      +  +     A +P+S   G
Sbjct: 129 LIVAVNKIDAFAEEVREEKVAKMQAKLASVFAKTKFK--GCAMLPVSARPG 177


>UniRef50_Q20447 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 702

 Score = 41.1 bits (92), Expect = 0.036
 Identities = 29/73 (39%), Positives = 34/73 (46%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           VT +D PGH  F      G   AD  VL+VAA  G  E       QT +    A    V 
Sbjct: 206 VTFLDTPGHAAFASMRARGAKGADIVVLVVAADDGVKE-------QTAQSIKFAKDANV- 257

Query: 478 QLIVGVNKMDSLN 516
           QL+V VNK+D  N
Sbjct: 258 QLVVAVNKIDKPN 270


>UniRef50_A7QHK9 Cluster: Chromosome chr5 scaffold_98, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_98, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 161

 Score = 40.7 bits (91), Expect = 0.048
 Identities = 22/46 (47%), Positives = 24/46 (52%)
 Frame = -1

Query: 242 TLSL*FVQYPSIFEGSFTHFXXXXXXXLDGTFVNTTTFVDQVTSGG 105
           TL L FVQ+P I EG   HF       LD   VN +  VDQVT  G
Sbjct: 85  TLRLQFVQHPGILEGLLVHFSCLLFKPLDNMLVNISKHVDQVTREG 130


>UniRef50_Q9W2H0 Cluster: CG9841-PA; n=1; Drosophila
           melanogaster|Rep: CG9841-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 511

 Score = 40.7 bits (91), Expect = 0.048
 Identities = 34/116 (29%), Positives = 50/116 (43%)
 Frame = +1

Query: 301 TIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 480
           T +D PGH   I+ +I G    D  +L+V A  G       K  QT E  L+   L  K+
Sbjct: 70  TFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG-------KQTQTAE-CLIIGELLQKK 121

Query: 481 LIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHGDNMLE 648
           LIV +NK+D    +  +  L K R +   T     +    V    +S   G ++ E
Sbjct: 122 LIVVINKIDVYPENQRASKLEKLRLRLAKTLEATTFG-GQVPICAVSALQGTHIAE 176


>UniRef50_A3FPW4 Cluster: Elongation factor-like protein; n=3;
           Cryptosporidium|Rep: Elongation factor-like protein -
           Cryptosporidium parvum Iowa II
          Length = 1100

 Score = 40.7 bits (91), Expect = 0.048
 Identities = 30/89 (33%), Positives = 47/89 (52%)
 Frame = +1

Query: 247 RYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISK 426
           +Y+ +I L + E   Y + +ID+PGH DF   +I+    +D A+L+V    G        
Sbjct: 66  KYEEEIKL-EVEDGDYLINLIDSPGHVDFTYEVISSLRISDGALLLVDVAEG-------I 117

Query: 427 NGQTREHALLAFTLGVKQLIVGVNKMDSL 513
             QTR+    AF   +K ++V +NKMD L
Sbjct: 118 GDQTRKVLQHAFKERLKIILV-LNKMDRL 145


>UniRef50_Q89AC9 Cluster: GTP-binding protein TypA/BipA homolog;
           n=93; Bacteria|Rep: GTP-binding protein TypA/BipA
           homolog - Buchnera aphidicola subsp. Baizongia pistaciae
          Length = 611

 Score = 40.7 bits (91), Expect = 0.048
 Identities = 27/73 (36%), Positives = 37/73 (50%)
 Frame = +1

Query: 289 KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTL 468
           KY + IID PGH DF   +    S  D  +L+V A  G          QTR     AF+ 
Sbjct: 71  KYRINIIDTPGHADFGGEVERILSMVDSVLLVVDALEGPMP-------QTRFVTQKAFSY 123

Query: 469 GVKQLIVGVNKMD 507
           G+K ++V +NK+D
Sbjct: 124 GIKPIVV-INKID 135


>UniRef50_Q4FVL5 Cluster: Translation initiation factor IF-2; n=152;
           Proteobacteria|Rep: Translation initiation factor IF-2 -
           Psychrobacter arcticum
          Length = 908

 Score = 40.7 bits (91), Expect = 0.048
 Identities = 27/82 (32%), Positives = 39/82 (47%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  +  +T++  +T +D PGH  F      G    D  VL+VAA  G     + +  +  
Sbjct: 448 IGAYHVKTARGVITFLDTPGHAAFSAMRSRGAQATDIVVLVVAADDGM----MPQTEEAI 503

Query: 442 EHALLAFTLGVKQLIVGVNKMD 507
           +HA  A T     LIV +NKMD
Sbjct: 504 DHARAAGT----PLIVAINKMD 521


>UniRef50_Q72ER1 Cluster: Translation initiation factor IF-2; n=3;
           Desulfovibrionaceae|Rep: Translation initiation factor
           IF-2 - Desulfovibrio vulgaris (strain Hildenborough /
           ATCC 29579 / NCIMB8303)
          Length = 1079

 Score = 40.7 bits (91), Expect = 0.048
 Identities = 29/82 (35%), Positives = 36/82 (43%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  +   T K  +  +D PGH  F      G    D  VL+VAA  G  E       QTR
Sbjct: 617 IGAYHVTTKKGEIVFLDTPGHEAFTAMRARGAQITDLVVLVVAADDGVME-------QTR 669

Query: 442 EHALLAFTLGVKQLIVGVNKMD 507
           E    +   GV  ++V VNKMD
Sbjct: 670 EAVNHSKAAGV-PIMVAVNKMD 690


>UniRef50_Q5PAJ5 Cluster: Translation initiation factor IF-2; n=3;
           Anaplasma|Rep: Translation initiation factor IF-2 -
           Anaplasma marginale (strain St. Maries)
          Length = 832

 Score = 40.3 bits (90), Expect = 0.063
 Identities = 38/129 (29%), Positives = 56/129 (43%), Gaps = 2/129 (1%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  ++ +     +T +D PGH  F      GT+  D  VL+VAA  G          QT 
Sbjct: 370 IGAYQIDVDGKKITFLDTPGHEAFSDMRARGTNVTDIVVLVVAADDGVMP-------QTV 422

Query: 442 EHALLAFTLGVKQLIVGVNKMD--SLNHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVP 615
           E      T GV  ++V VNK+D    N   ++ DL     ++     +LG     V  VP
Sbjct: 423 ESINHVKTAGV-SMVVAVNKIDRSDANVDKITNDL----LQHGVVPEKLG---GDVMIVP 474

Query: 616 ISGWHGDNM 642
           +S   G+N+
Sbjct: 475 VSAKTGENL 483


>UniRef50_Q1ZR84 Cluster: Selenocysteinyl-tRNA-specific translation
           factor; n=2; Vibrionaceae|Rep:
           Selenocysteinyl-tRNA-specific translation factor -
           Vibrio angustum S14
          Length = 640

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 24/67 (35%), Positives = 31/67 (46%)
 Frame = +1

Query: 307 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 486
           ID PGH  F+ NM+ G   A  A+LIVA   G          Q+ EH  +   L +  L 
Sbjct: 61  IDVPGHEKFLSNMLAGVGTAHHAMLIVAGDEGMM-------AQSYEHLAILRLLAMDSLT 113

Query: 487 VGVNKMD 507
           V + K D
Sbjct: 114 VVITKSD 120


>UniRef50_A6Q226 Cluster: Translation initiation factor IF-2; n=5;
           Epsilonproteobacteria|Rep: Translation initiation factor
           IF-2 - Nitratiruptor sp. (strain SB155-2)
          Length = 843

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 32/97 (32%), Positives = 43/97 (44%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  +  E     +T ID PGH  F +    G    D A+++VAA  G          QT 
Sbjct: 381 IGAYMIEKDGKRITFIDTPGHEAFTEMRARGAQATDIAIIVVAADDG-------VKPQTV 433

Query: 442 EHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSR 552
           E    A T  V  +IV +NK+D       +PDL KS+
Sbjct: 434 EAVNHAKTADV-PMIVAINKIDK---PEANPDLVKSQ 466


>UniRef50_A6DKQ3 Cluster: Translation initiation factor IF-2; n=1;
           Lentisphaera araneosa HTCC2155|Rep: Translation
           initiation factor IF-2 - Lentisphaera araneosa HTCC2155
          Length = 683

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 27/70 (38%), Positives = 33/70 (47%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           VT +D PGH  F      G    D  +LIVAA  G        N QT+E AL       +
Sbjct: 235 VTFLDTPGHSAFSAMRQRGADVTDICILIVAADDG-------VNAQTKE-ALKIIMDSER 286

Query: 478 QLIVGVNKMD 507
            LI+ +NKMD
Sbjct: 287 PLIIAINKMD 296


>UniRef50_A1SQK9 Cluster: Small GTP-binding protein; n=2;
           Actinomycetales|Rep: Small GTP-binding protein -
           Nocardioides sp. (strain BAA-499 / JS614)
          Length = 701

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 414
           V +ID PG+ DF+  +  G   ADCA+ ++AA  G  +A
Sbjct: 91  VNLIDTPGYADFVGELRAGLRAADCALFVIAANDGVDDA 129


>UniRef50_Q4Q2R0 Cluster: Selenocysteine-specific elongation factor,
           putative; n=3; Leishmania|Rep: Selenocysteine-specific
           elongation factor, putative - Leishmania major
          Length = 678

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 36/116 (31%), Positives = 52/116 (44%), Gaps = 5/116 (4%)
 Frame = +1

Query: 280 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 459
           E +K   T++D PGH   I+ ++ G    D  VL+V A  G          QT E  +L 
Sbjct: 71  ELTKVQCTLVDCPGHASLIRTVVGGAQIIDAMVLVVDATKG-------IQVQTAECLVLG 123

Query: 460 FTLGVKQLIVGVNKMDSLNHHTVSP-----DLRKSRRKYPHTSRRLGYNPAAVAFV 612
             L  K L+V +NK+D++    VSP      L   +RK     RR  +   A+  V
Sbjct: 124 EVL-AKPLVVVLNKIDAI--QGVSPAGKEAALAALKRKLQQVFRRTRWPTVAIVEV 176


>UniRef50_Q48791 Cluster: Tetracycline resistance protein tetS
           (Tet(S)); n=345; root|Rep: Tetracycline resistance
           protein tetS (Tet(S)) - Listeria monocytogenes
          Length = 641

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 24/84 (28%), Positives = 41/84 (48%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           I  A+  F+     V I+D PGH DF+ ++    S  D A+L+++A     + G+    +
Sbjct: 56  IQTAITSFQRENVKVNIVDTPGHMDFLADVYRSLSVLDGAILLISA-----KDGVQSQTR 110

Query: 436 TREHALLAFTLGVKQLIVGVNKMD 507
              HAL    +    +I  +NK+D
Sbjct: 111 ILFHALRKMNI---PIIFFINKID 131



 Score = 34.3 bits (75), Expect = 4.1
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +3

Query: 63  INIVVIGHVDSGKSTTTGHLIYKCGGI 143
           INI ++ HVD+GK+T T  L+Y  G I
Sbjct: 4   INIGILAHVDAGKTTLTESLLYSSGAI 30


>UniRef50_Q609C0 Cluster: Translation initiation factor IF-2; n=8;
           Gammaproteobacteria|Rep: Translation initiation factor
           IF-2 - Methylococcus capsulatus
          Length = 868

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 28/82 (34%), Positives = 37/82 (45%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  ++ +T    +T +D PGH  F      G    D  VL+VAA  G          QTR
Sbjct: 408 IGAYQVKTDHGSITFLDTPGHAAFTAMRARGAKVTDIVVLVVAADDGVMP-------QTR 460

Query: 442 EHALLAFTLGVKQLIVGVNKMD 507
           E    +   GV  L+V +NKMD
Sbjct: 461 EAVEHSRAAGV-PLVVAMNKMD 481


>UniRef50_Q30WJ0 Cluster: Translation initiation factor IF-2; n=16;
           Bacteria|Rep: Translation initiation factor IF-2 -
           Desulfovibrio desulfuricans (strain G20)
          Length = 984

 Score = 39.9 bits (89), Expect = 0.083
 Identities = 27/82 (32%), Positives = 36/82 (43%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  +   T +  +  +D PGH  F      G    D  +L+VAA  G  E       QTR
Sbjct: 521 IGAYHVSTKRGDIVFLDTPGHEAFTAMRARGAQVTDLVILVVAADDGVME-------QTR 573

Query: 442 EHALLAFTLGVKQLIVGVNKMD 507
           E    A   GV  ++V VNK+D
Sbjct: 574 EAISHAKAAGV-PIVVAVNKID 594


>UniRef50_Q9RXC2 Cluster: Elongation factor G; n=2; Deinococcus|Rep:
           Elongation factor G - Deinococcus radiodurans
          Length = 678

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 28/102 (27%), Positives = 53/102 (51%), Gaps = 2/102 (1%)
 Frame = +1

Query: 250 YQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKN 429
           + I  A+ +  +    +T++D PG+ DF++ +      AD A+++V+A +G  E G  + 
Sbjct: 63  FSIQTAVLRLCSEGVDITLLDTPGYADFVREIRGAVRAADAALVVVSAVSG-VEVGTERV 121

Query: 430 GQTREHALLAFTLGVKQLIVGVNKM--DSLNHHTVSPDLRKS 549
             T +        G+ +LI  +NKM  D  + +T+  D+R S
Sbjct: 122 WATADR------FGMPRLI-ALNKMDRDRADFYTMLADVRAS 156


>UniRef50_A6QBQ5 Cluster: Translation initiation factor IF-2; n=1;
           Sulfurovum sp. NBC37-1|Rep: Translation initiation
           factor IF-2 - Sulfurovum sp. (strain NBC37-1)
          Length = 906

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 27/97 (27%), Positives = 44/97 (45%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           +  ++ E +   +T +D PGH  F +    G    D  +++VAA  G          QT+
Sbjct: 444 VGAYQVEKNGKKITFVDTPGHEAFTEMRARGAQATDIVIIVVAADDGVMP-------QTK 496

Query: 442 EHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSR 552
           E        GV  +I+ +NKMD     + +PD  KS+
Sbjct: 497 EAIAHTKAAGV-PMIIAMNKMDK---ESANPDNIKSQ 529


>UniRef50_Q08491 Cluster: Superkiller protein 7; n=2; Saccharomyces
           cerevisiae|Rep: Superkiller protein 7 - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 747

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +3

Query: 60  HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMG-KGSFKYAWVLDKLKA 236
           ++  + +G  ++GKST  GHL+Y    I   ++ + +K++  +    S  +  +LD  K 
Sbjct: 267 NLTCLFLGDTNAGKSTLLGHLLYDLNEISMSSMRELQKKSSNLDPSSSNSFKVILDNTKT 326

Query: 237 ERE 245
           ERE
Sbjct: 327 ERE 329


>UniRef50_UPI00006CBFC8 Cluster: Elongation factor Tu GTP binding
           domain containing protein; n=1; Tetrahymena thermophila
           SB210|Rep: Elongation factor Tu GTP binding domain
           containing protein - Tetrahymena thermophila SB210
          Length = 581

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 4/115 (3%)
 Frame = +1

Query: 301 TIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 480
           T++D PGH   IK +I G S  D   L++     +   GI    QT E  L+   L +++
Sbjct: 97  TLVDCPGHASLIKTIIGGASIIDIMFLVI-----DINKGIQT--QTAE-CLVIGELLMQK 148

Query: 481 LIVGVNKMDSL----NHHTVSPDLRKSRRKYPHTSRRLGYNPAAVAFVPISGWHG 633
           +IV +NK+D +       T+S  + + R+ +  T  + G   A+V  +PI+   G
Sbjct: 149 MIVVLNKIDMIPEDKRAETISKKMEQLRKVFSKT--KFG---ASVPMIPIAASQG 198


>UniRef50_Q6LH28 Cluster: Hypothetical selenocysteine-specific
           translation elongation factor; n=2; Photobacterium
           profundum|Rep: Hypothetical selenocysteine-specific
           translation elongation factor - Photobacterium profundum
           (Photobacterium sp. (strain SS9))
          Length = 574

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           V +ID PGH  FI+NM+ G    D  + +VAA  G
Sbjct: 18  VGVIDVPGHERFIRNMVAGVWSLDMVLFVVAADEG 52


>UniRef50_Q1Q1G5 Cluster: Strongly similar to translation initiation
           factor IF-2; n=1; Candidatus Kuenenia
           stuttgartiensis|Rep: Strongly similar to translation
           initiation factor IF-2 - Candidatus Kuenenia
           stuttgartiensis
          Length = 742

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 29/89 (32%), Positives = 40/89 (44%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I   K ET+  +V  +D PGH  F      G +  D  VL+VAA  G          QT 
Sbjct: 279 IGAHKVETNGKHVVFLDTPGHEAFTAMRARGANVTDVVVLVVAADDGVMP-------QTE 331

Query: 442 EHALLAFTLGVKQLIVGVNKMDSLNHHTV 528
           E    A    V  +IV +NK+D  + +T+
Sbjct: 332 EAINHAKAANV-PIIVAINKIDKPSANTL 359


>UniRef50_Q1JYY0 Cluster: Selenocysteine-specific translation
           elongation factor; n=2; Desulfuromonas acetoxidans DSM
           684|Rep: Selenocysteine-specific translation elongation
           factor - Desulfuromonas acetoxidans DSM 684
          Length = 642

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 21/68 (30%), Positives = 33/68 (48%)
 Frame = +1

Query: 304 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 483
           ++D PGH  FI NM+ G    D  +L++    G          QT EH  +   L +++ 
Sbjct: 63  VVDVPGHERFISNMLAGIGGIDLVLLVIDVMEGMMP-------QTHEHLEILELLQIRRG 115

Query: 484 IVGVNKMD 507
           I+ +NK D
Sbjct: 116 IIVLNKCD 123


>UniRef50_Q0EZ74 Cluster: Translation initiation factor IF-2; n=1;
           Mariprofundus ferrooxydans PV-1|Rep: Translation
           initiation factor IF-2 - Mariprofundus ferrooxydans PV-1
          Length = 1045

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 29/70 (41%), Positives = 32/70 (45%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           V  ID PGH  F      G    D AVL+VAA  G     I    +   HA  A   GV 
Sbjct: 597 VVFIDTPGHEAFTSLRARGAGMTDVAVLVVAADDGVMPQTI----EALNHAKAA---GV- 648

Query: 478 QLIVGVNKMD 507
            +IV VNKMD
Sbjct: 649 PMIVAVNKMD 658


>UniRef50_A6MVX8 Cluster: Translation initiation factor 2; n=1;
           Rhodomonas salina|Rep: Translation initiation factor 2 -
           Rhodomonas salina (Cryptomonas salina)
          Length = 751

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 43/166 (25%), Positives = 70/166 (42%)
 Frame = +1

Query: 241 VXRYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 420
           +  Y+++I  +K +T K  +T +D PGH  F      G    D A+L+VAA  G      
Sbjct: 289 IGAYEVEID-YKDQTKK--LTFLDTPGHEAFSGMRSRGVQVTDIAILVVAADDG------ 339

Query: 421 SKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNPAA 600
               QT E A+         +IV +NK+D  N      ++++   +Y       G +   
Sbjct: 340 -VKPQTVE-AIKYIQAANVPIIVAINKIDKENADI--ENIKQQLTQYNLIPENWGGDTLM 395

Query: 601 VAFVPISGWHGDNMLEPSTKMPWFKGWQVERKEGKADGKCLIEALD 738
           V    + G + +N+LE    +   +  +   K  KA G  L   LD
Sbjct: 396 VPISAMKGTNMENLLEMIILVSEIEDLKANTKV-KAQGTVLEAHLD 440


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 903,193,945
Number of Sequences: 1657284
Number of extensions: 18869094
Number of successful extensions: 56658
Number of sequences better than 10.0: 448
Number of HSP's better than 10.0 without gapping: 52797
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56352
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 78702453312
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -