SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30104.Seq
         (674 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI000051A21B Cluster: PREDICTED: similar to CG3862-PA;...    81   2e-14
UniRef50_UPI0000D56F40 Cluster: PREDICTED: similar to CG3862-PA;...    77   5e-13
UniRef50_Q16W91 Cluster: Regulator of chromosome condensation; n...    74   3e-12
UniRef50_Q9VPU0 Cluster: CG3862-PA; n=3; Sophophora|Rep: CG3862-...    72   1e-11
UniRef50_UPI0000E46979 Cluster: PREDICTED: hypothetical protein;...    65   2e-09
UniRef50_Q96I51 Cluster: Williams-Beuren syndrome chromosome reg...    63   5e-09
UniRef50_Q5C3M7 Cluster: SJCHGC05517 protein; n=1; Schistosoma j...    40   0.073
UniRef50_A7RQF3 Cluster: Predicted protein; n=2; Nematostella ve...    34   2.7  
UniRef50_UPI000150A161 Cluster: hypothetical protein TTHERM_0047...    34   3.6  
UniRef50_Q86T82 Cluster: Ubiquitin carboxyl-terminal hydrolase 3...    33   8.4  

>UniRef50_UPI000051A21B Cluster: PREDICTED: similar to CG3862-PA;
           n=2; Apocrita|Rep: PREDICTED: similar to CG3862-PA -
           Apis mellifera
          Length = 443

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 51/150 (34%), Positives = 73/150 (48%)
 Frame = +2

Query: 218 PVSNKQKYRQTSHVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAERFDITN 397
           P+SN++ +R   +VWG A+ GALG                   +  P R SF ER D+TN
Sbjct: 41  PISNERDHRV--YVWGMADHGALGT------LKSTVYEKGISYIPKPKRLSFGERHDVTN 92

Query: 398 IACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPREIILWNFWLSYAPIYIPYKXXXX 577
           IACGYGFT  ++++++++ +FG+GINTDSQ+G+    +           PI +P K    
Sbjct: 93  IACGYGFTAFAVRSNDKNILFGSGINTDSQLGFDEKDKKFPNGLITEPRPINLPIK-DSS 151

Query: 578 XXXXXXXXXXXHNNPDRQRRCLYLGNNAYG 667
                      H           LGNNAYG
Sbjct: 152 TKVLDIAAGRAHLLVLTNEGLFTLGNNAYG 181


>UniRef50_UPI0000D56F40 Cluster: PREDICTED: similar to CG3862-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG3862-PA - Tribolium castaneum
          Length = 477

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 49/148 (33%), Positives = 65/148 (43%)
 Frame = +2

Query: 224 SNKQKYRQTSHVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAERFDITNIA 403
           ++K+ Y++   VWG   +GALGI   R                 P R  FAE+F +T  A
Sbjct: 74  TSKKSYKRV-FVWGNLMSGALGIPYLRRNENVMHRETVDI----PKRLGFAEKFPVTTAA 128

Query: 404 CGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPREIILWNFWLSYAPIYIPYKXXXXXX 583
           CG+GFT   + T  + K++GTG+NTDSQIG H  R+            I +P K      
Sbjct: 129 CGFGFTAFGVDTESEDKLYGTGLNTDSQIGRHEVRQGHPLEIIYFPQAIKLPLKNPTKTR 188

Query: 584 XXXXXXXXXHNNPDRQRRCLYLGNNAYG 667
                    H           LGNNAYG
Sbjct: 189 IRKLAAGRAHLVVLTDEGLFLLGNNAYG 216


>UniRef50_Q16W91 Cluster: Regulator of chromosome condensation; n=2;
           Culicidae|Rep: Regulator of chromosome condensation -
           Aedes aegypti (Yellowfever mosquito)
          Length = 456

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 37/82 (45%), Positives = 48/82 (58%)
 Frame = +2

Query: 254 HVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAERFDITNIACGYGFTVASI 433
           +VWG A TGALG+                 +V HP R +FAE  DI ++A GYGF+V + 
Sbjct: 52  YVWGLAATGALGLQTS----VKKQAKAHTDVVQHPSRLNFAENRDIVDVAAGYGFSVFAA 107

Query: 434 KTSEQHKVFGTGINTDSQIGYH 499
           K      ++GTGINTD+QIGYH
Sbjct: 108 KCRHGKSLWGTGINTDAQIGYH 129


>UniRef50_Q9VPU0 Cluster: CG3862-PA; n=3; Sophophora|Rep: CG3862-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 454

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 33/81 (40%), Positives = 48/81 (59%)
 Frame = +2

Query: 254 HVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAERFDITNIACGYGFTVASI 433
           +VWGF ETGALG+                 +V HP R  F+   +IT++A GYGFTV ++
Sbjct: 47  YVWGFQETGALGLQT----NVKKAKERYTEMVHHPTRLQFSNNNEITDVAAGYGFTVYAV 102

Query: 434 KTSEQHKVFGTGINTDSQIGY 496
              +   +FG+G+NTDSQ+G+
Sbjct: 103 NRDDGETLFGSGLNTDSQLGF 123


>UniRef50_UPI0000E46979 Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 455

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 39/99 (39%), Positives = 52/99 (52%), Gaps = 4/99 (4%)
 Frame = +2

Query: 215 IPVSNKQKYRQTS-HVWGFAETGALGI---HLPRXXXXXXXXXXXXXLVWHPMRSSFAER 382
           + +  K + R TS +VWGF  TGALG+     P               +  P +  F E+
Sbjct: 13  VQMVGKHRKRYTSVYVWGFTYTGALGVPSYFFPSQRKNPIRKPKKFQPI--PYKLKFDEK 70

Query: 383 FDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYH 499
             IT  ACGYGF++    T +  KV+G GINT+SQIGYH
Sbjct: 71  --ITTAACGYGFSLIGSHTQDTSKVWGMGINTNSQIGYH 107



 Score = 36.3 bits (80), Expect = 0.68
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +3

Query: 558 LTRAWECEIKAVAAGRAHTIILTDKEGVYT*VTMPMGQC 674
           LT+  +  +  V+ GR+H++ILTD+EG Y       GQC
Sbjct: 130 LTKPRKTRVSQVSCGRSHSLILTDEEGEYRLGNNSHGQC 168


>UniRef50_Q96I51 Cluster: Williams-Beuren syndrome chromosome region
           16 protein; n=30; Deuterostomia|Rep: Williams-Beuren
           syndrome chromosome region 16 protein - Homo sapiens
           (Human)
          Length = 464

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 43/144 (29%), Positives = 70/144 (48%), Gaps = 7/144 (4%)
 Frame = +2

Query: 257 VWGFAETGALGIH---LPRXXXXXXXXXXXXXLVWH-PMRSSFAERFDITNIACGYGFTV 424
           VWGF+ +GALG+    +P               +   P R    ++  I++ ACGYGFT+
Sbjct: 63  VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQK--ISSAACGYGFTL 120

Query: 425 ASIKTSEQHKVFGTGINTDSQIGYHSPREIIL--WNFWLSYAPIYIPYKXXXXXXXXXXX 598
            S KT++  KV+G G+N DSQ+G+H  R+     + + L  +P+ +P             
Sbjct: 121 LSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVS 180

Query: 599 XXXXHNNPDRQRRCLY-LGNNAYG 667
               H+     R  ++ +GNN+YG
Sbjct: 181 CGRAHSLVLTDREGVFSMGNNSYG 204



 Score = 39.5 bits (88), Expect = 0.073
 Identities = 17/39 (43%), Positives = 25/39 (64%)
 Frame = +3

Query: 558 LTRAWECEIKAVAAGRAHTIILTDKEGVYT*VTMPMGQC 674
           L R  E  +  V+ GRAH+++LTD+EGV++      GQC
Sbjct: 168 LDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQC 206


>UniRef50_Q5C3M7 Cluster: SJCHGC05517 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05517 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 279

 Score = 39.5 bits (88), Expect = 0.073
 Identities = 33/102 (32%), Positives = 43/102 (42%), Gaps = 2/102 (1%)
 Frame = +2

Query: 203 AFTNIPVSNKQKYRQTSHVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAER 382
           A  N+   +  K +Q  +V+GF  TGALG                   V HP+       
Sbjct: 36  AVYNVHSRDSLKSKQV-YVFGFTATGALG----NKTYLGQRGKPGIVGVSHPVPLKCLSS 90

Query: 383 FDIT-NIACGYGFTVASIKTSE-QHKVFGTGINTDSQIGYHS 502
             I    ACGYGFT    + S     V+G GIN+D Q+G  S
Sbjct: 91  LGIPIKAACGYGFTTYICEGSNGDFGVYGCGINSDGQLGSQS 132


>UniRef50_A7RQF3 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 394

 Score = 34.3 bits (75), Expect = 2.7
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +3

Query: 582 IKAVAAGRAHTIILTDKEGVYT*VTMPMGQC 674
           I  +A GR+H ++LTD EGV+       GQC
Sbjct: 107 ITQIACGRSHALVLTDSEGVFVIGGNSQGQC 137


>UniRef50_UPI000150A161 Cluster: hypothetical protein
           TTHERM_00473300; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00473300 - Tetrahymena
           thermophila SB210
          Length = 298

 Score = 33.9 bits (74), Expect = 3.6
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = +3

Query: 96  NMYAAKFLIHRRSPV--FLLNRVSITTKKKVHDPSEEELLPIFQYPISKS 239
           N++ +  LI + S +  FLLN + +TTK K+ D S E+    +  PISK+
Sbjct: 20  NIFISLALIPQTSFIHSFLLNTIPLTTKMKIQDDSFEQSPQSYSKPISKT 69


>UniRef50_Q86T82 Cluster: Ubiquitin carboxyl-terminal hydrolase 37;
           n=35; Tetrapoda|Rep: Ubiquitin carboxyl-terminal
           hydrolase 37 - Homo sapiens (Human)
          Length = 979

 Score = 32.7 bits (71), Expect = 8.4
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = -2

Query: 598 AATALISHSQALVRYINRCIAKPEVPKDDFSW*MVSNLGICIDTGTEN 455
           +A   IS      + +N CI  P  P   F++   S+L +C+D+ +E+
Sbjct: 607 SAHMAISRPLKASQMVNSCITSPSTPSKKFTFKSKSSLALCLDSDSED 654


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 673,746,231
Number of Sequences: 1657284
Number of extensions: 13267907
Number of successful extensions: 30668
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 29635
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30652
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 52066120554
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -