BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30001 (340 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6FDT0 Cluster: Hemagglutinin/hemolysin-related protein... 31 3.8 UniRef50_UPI0000519A5C Cluster: PREDICTED: similar to CG33275-PC... 30 8.8 UniRef50_A6R918 Cluster: Putative uncharacterized protein; n=1; ... 30 8.8 UniRef50_A4RKR8 Cluster: Predicted protein; n=1; Magnaporthe gri... 30 8.8 >UniRef50_A6FDT0 Cluster: Hemagglutinin/hemolysin-related protein; n=1; Moritella sp. PE36|Rep: Hemagglutinin/hemolysin-related protein - Moritella sp. PE36 Length = 389 Score = 31.5 bits (68), Expect = 3.8 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 Query: 76 PVFSPGKMTSVSVARGS*LVNCVRNGEGV 162 P+F G++TS V +GS +N V+NG G+ Sbjct: 127 PIFDDGQLTSFVVNKGSIDINSVQNGRGL 155 >UniRef50_UPI0000519A5C Cluster: PREDICTED: similar to CG33275-PC, isoform C isoform 1; n=1; Apis mellifera|Rep: PREDICTED: similar to CG33275-PC, isoform C isoform 1 - Apis mellifera Length = 1121 Score = 30.3 bits (65), Expect = 8.8 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 161 LQTLNAYILDTSKCCLTVDRLKHFCLCRRLEGE 259 L+ Y+ DTS+CCL DR + RL GE Sbjct: 417 LEDRREYLEDTSRCCLLQDRAYEWAQEARLAGE 449 >UniRef50_A6R918 Cluster: Putative uncharacterized protein; n=1; Ajellomyces capsulatus NAm1|Rep: Putative uncharacterized protein - Ajellomyces capsulatus NAm1 Length = 638 Score = 30.3 bits (65), Expect = 8.8 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 16 PLHGQKEKSLRKKKITSFISPVFSPGKMTSVSVARG 123 PLHG+ +R+K T F++ V S +T+ ARG Sbjct: 301 PLHGKHPPQVRQKNFTRFVNSVTSSILLTTDVAARG 336 >UniRef50_A4RKR8 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 568 Score = 30.3 bits (65), Expect = 8.8 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = -3 Query: 254 LRVYGKDRNVSTCRRSDNISTCPKYMRSTFATPSPFRTQFTNQLPLAT 111 +R+ G D VS+ S +IST + S+ +TPS + F++ P+AT Sbjct: 208 VRMAGMDSAVSSTSSSTSISTSSSSLTSSSSTPS-LASTFSSSTPVAT 254 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 290,232,530 Number of Sequences: 1657284 Number of extensions: 4944504 Number of successful extensions: 14151 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14147 length of database: 575,637,011 effective HSP length: 88 effective length of database: 429,796,019 effective search space used: 10315104456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -