SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A21
         (651 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7Q5J0 Cluster: ENSANGP00000021022; n=4; Culicidae|Rep:...    51   2e-05

>UniRef50_Q7Q5J0 Cluster: ENSANGP00000021022; n=4; Culicidae|Rep:
           ENSANGP00000021022 - Anopheles gambiae str. PEST
          Length = 347

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 33/121 (27%), Positives = 43/121 (35%), Gaps = 2/121 (1%)
 Frame = +2

Query: 155 IALLTILIISQVYSAP--QFITFKDGKIGVNFXXXXXXXXXXXXXXXXXXXXXXXXXXXT 328
           IALL ++I+    ++P  QF+TF+DGK GVNF                           T
Sbjct: 8   IALLILVIVQCTLASPVPQFLTFRDGKFGVNFGGYHAEAGLGGLLTGNSAHGGLSASAGT 67

Query: 329 PHGQSARXXXXXXXXXXXXXXXXXXXXXXXXXNVKAEAGLAGRVASEDVAGNGFATAQAG 508
           PHGQ A                           V A A + G +     AG   A + AG
Sbjct: 68  PHGQQAGAGIGGLLGGNERTAGGAYAGATAGHGVGASAAIGGGLDGAGGAGGAGAESHAG 127

Query: 509 G 511
           G
Sbjct: 128 G 128


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 429,152,546
Number of Sequences: 1657284
Number of extensions: 6176948
Number of successful extensions: 14595
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 14252
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14590
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 48760335122
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -