SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120041.Seq
         (827 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P17500 Cluster: Major capsid protein; n=15; Nucleopolyh...   177   3e-43
UniRef50_Q80LM9 Cluster: Major capsid protein VP39; n=1; Adoxoph...   119   1e-25
UniRef50_Q8QLD5 Cluster: Vp39 capsid; n=1; Mamestra configurata ...   113   4e-24
UniRef50_P35840 Cluster: Major capsid protein; n=12; Nucleopolyh...   110   5e-23
UniRef50_Q0N423 Cluster: VP39; n=1; Clanis bilineata nucleopolyh...    86   1e-15
UniRef50_Q9DWZ8 Cluster: VP39; n=2; Nucleopolyhedrovirus|Rep: VP...    68   3e-10
UniRef50_Q7T9T4 Cluster: Vp39-capsid; n=5; Granulovirus|Rep: Vp3...    61   4e-08
UniRef50_Q6QXM6 Cluster: ORF086; n=1; Agrotis segetum granulovir...    49   1e-04
UniRef50_Q0ZNY8 Cluster: Major viral capsid protein 39; n=3; Nuc...    49   2e-04
UniRef50_Q9DVV4 Cluster: PxORF79 peptide; n=1; Plutella xylostel...    48   2e-04
UniRef50_Q9PYT2 Cluster: ORF111; n=4; Granulovirus|Rep: ORF111 -...    47   5e-04
UniRef50_Q8JRX1 Cluster: Capsid protein VP39; n=1; Phthorimaea o...    46   0.002
UniRef50_A0NRY8 Cluster: Short-chain dehydrogenase/reductase SDR...    35   2.9  
UniRef50_A5DZG4 Cluster: Guanine nucleotide-binding protein alph...    35   2.9  
UniRef50_Q8YXH3 Cluster: Zam protein; n=6; Cyanobacteria|Rep: Za...    33   8.7  
UniRef50_Q5QBL6 Cluster: Cathepsin L; n=1; Culicoides sonorensis...    33   8.7  
UniRef50_Q8PX46 Cluster: Exopolyphosphatase; n=4; Methanosarcina...    33   8.7  
UniRef50_P26591 Cluster: Glutamate receptor precursor; n=5; Moll...    33   8.7  

>UniRef50_P17500 Cluster: Major capsid protein; n=15;
           Nucleopolyhedrovirus|Rep: Major capsid protein - Orgyia
           pseudotsugata multicapsid polyhedrosis virus (OpMNPV)
          Length = 351

 Score =  177 bits (431), Expect = 3e-43
 Identities = 109/248 (43%), Positives = 145/248 (58%), Gaps = 7/248 (2%)
 Frame = +3

Query: 39  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMS 218
           MAL+  G++ R+   N CIF +I  FD+C+TY+SPCS DA  DDGWFIC+ HL  RFKMS
Sbjct: 1   MALVSPGVSSRRS-TNHCIFGAIEPFDSCVTYRSPCSSDASVDDGWFICDYHLKLRFKMS 59

Query: 219 KMVLPIFDEDDNNSK*RSLGI*LEIKKEVSSEF*FQAQPITKRCLI*TV*CKPNN*---S 389
           KMVLPI+DED +N   R++   L   KE       +   +  R    TV   P       
Sbjct: 60  KMVLPIYDED-DNQYKRTIARHLVGHKERG----VKRILVPTRANYMTVFNLPGMMLAEQ 114

Query: 390 FI*YITTKRRLT---LYATI*NIPKFHKRHATRYTQRLRNYKNILDTTNPNTFCSRVSRD 560
            I ++    RL    + A++ N   F     +         +NIL  T+P  +CSRV+ D
Sbjct: 115 LIFHLIYDNRLEVNRICASLKNNENFIDNTYSVVESVYSATRNILSLTDPQAYCSRVAND 174

Query: 561 ELRFFDVTNA-RTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCII 737
           ++RFFD       ++ G GD +FNN  GFL+NLIRRAVAPE LQID+E+LR RN  TC+I
Sbjct: 175 DVRFFDANVVDNNYQAGNGDTVFNNMPGFLRNLIRRAVAPETLQIDSEDLRLRNCNTCVI 234

Query: 738 DETGLVAS 761
           + TGLVA+
Sbjct: 235 NNTGLVAT 242



 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 44/66 (66%), Positives = 51/66 (77%)
 Frame = +2

Query: 257 FKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICD 436
           +K TIARHLVG+KERG+KRIL+P+  NY  VFNL  MM AEQLIFHLIY+N   VN IC 
Sbjct: 73  YKRTIARHLVGHKERGVKRILVPTRANYMTVFNLPGMMLAEQLIFHLIYDNRLEVNRICA 132

Query: 437 NLKYTE 454
           +LK  E
Sbjct: 133 SLKNNE 138



 Score = 34.7 bits (76), Expect = 2.9
 Identities = 13/17 (76%), Positives = 17/17 (100%)
 Frame = +2

Query: 776 ELYNPIRSSDIMKSQPN 826
           ELYNP+RSSDI+K++PN
Sbjct: 247 ELYNPVRSSDIIKTRPN 263


>UniRef50_Q80LM9 Cluster: Major capsid protein VP39; n=1; Adoxophyes
           honmai NPV|Rep: Major capsid protein VP39 - Adoxophyes
           honmai nucleopolyhedrovirus
          Length = 312

 Score =  119 bits (286), Expect = 1e-25
 Identities = 86/243 (35%), Positives = 120/243 (49%), Gaps = 3/243 (1%)
 Frame = +3

Query: 39  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMS 218
           MAL+P G+   +   N CIFA + SFDAC  Y + CS DA  +DGW+IC  H    FKM 
Sbjct: 1   MALVPAGLTSSRSNSN-CIFAGVQSFDACYRYPNECSKDADSNDGWYICEYHASVHFKME 59

Query: 219 KMVLPIFDEDDNNSK*RSLGI*LEIKKEVSSEF*FQAQPITKRCLI*TV*CKPNN*SFI* 398
           KM L I D  DN    R++G  L    E  +             ++  V   P   + I 
Sbjct: 60  KMSLAIPDA-DNKVLFRTVGRSLVKHTEEGTARILVPNKNNYESVL-NVQDLPLAEALII 117

Query: 399 YITTKRRLTLYATI*NIPKFHKRHATRYTQRLRNYKN---ILDTTNPNTFCSRVSRDELR 569
           ++  +  L     I    KF +  A RY    + Y N   +L+  NP+ FC+ VS   LR
Sbjct: 118 HMIYE-NLEKQKEICERLKFTEHFADRYKNVQKLYSNTMSVLNMANPDHFCAEVSLTSLR 176

Query: 570 FFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCIIDETG 749
            F   +         D  F  +  F++NL+ +AVAPE ++I TE++  RN +TCII+ TG
Sbjct: 177 QF---SNEIGNEPAQDTNFELFPKFIKNLVTKAVAPEIMKIGTEDIYIRNCSTCIINSTG 233

Query: 750 LVA 758
           LVA
Sbjct: 234 LVA 236



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/63 (46%), Positives = 39/63 (61%)
 Frame = +2

Query: 266 TIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLK 445
           T+ R LV + E G  RIL+P+  NY+ V N+  +  AE LI H+IY N E    IC+ LK
Sbjct: 76  TVGRSLVKHTEEGTARILVPNKNNYESVLNVQDLPLAEALIIHMIYENLEKQKEICERLK 135

Query: 446 YTE 454
           +TE
Sbjct: 136 FTE 138


>UniRef50_Q8QLD5 Cluster: Vp39 capsid; n=1; Mamestra configurata
           NPV-A|Rep: Vp39 capsid - Mamestra configurata NPV-A
          Length = 325

 Score =  113 bits (273), Expect = 4e-24
 Identities = 83/243 (34%), Positives = 118/243 (48%), Gaps = 2/243 (0%)
 Frame = +3

Query: 39  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMS 218
           MAL P G    Q + N CIF +I  FD C TY SPCS DA  +DGWFIC  HL  RF+M 
Sbjct: 1   MALTPYGS--NQPQSNNCIFGAIRPFDTCRTYSSPCSNDASQEDGWFICEYHLSIRFRME 58

Query: 219 KMVLPIFDEDDNNSK*RSLGI*LEIKKEVSSEF*FQAQPITKRCLI*TV*CKPNN*SF-I 395
           KMVLPI D +      RS+G  L I    S+      +   +  L       P    F +
Sbjct: 59  KMVLPIPDAEGTIYN-RSVGKSL-ISGTESNRVLIPTKTNYEDVLKLPSMSLPEQLIFHM 116

Query: 396 *YITTKRRLTLYATI*NIPKFHKRHATRYTQRLRN-YKNILDTTNPNTFCSRVSRDELRF 572
            Y    ++  +   +     FH     +  +R+ N    +L  TNP  FC+RV+ +  R 
Sbjct: 117 IYDEPDKQNEICKLLQYNENFHS-DLYKVVERVYNKTAEVLAKTNPERFCARVNINNFRS 175

Query: 573 FDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCIIDETGL 752
           +   +       + +  +N   GFL+NLI ++VAP  +      +  RN+ATC I++ GL
Sbjct: 176 YGTAD----ETDIANVTYNAMPGFLKNLINKSVAPCTMDFPGGTINLRNAATCAINQQGL 231

Query: 753 VAS 761
           VA+
Sbjct: 232 VAT 234



 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 27/66 (40%), Positives = 40/66 (60%)
 Frame = +2

Query: 257 FKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICD 436
           +  ++ + L+   E    R+LIP+ TNY++V  L SM   EQLIFH+IY+  +  N IC 
Sbjct: 72  YNRSVGKSLISGTESN--RVLIPTKTNYEDVLKLPSMSLPEQLIFHMIYDEPDKQNEICK 129

Query: 437 NLKYTE 454
            L+Y E
Sbjct: 130 LLQYNE 135


>UniRef50_P35840 Cluster: Major capsid protein; n=12;
           Nucleopolyhedrovirus|Rep: Major capsid protein -
           Lymantria dispar multicapsid nuclear polyhedrosis virus
           (LdMNPV)
          Length = 356

 Score =  110 bits (264), Expect = 5e-23
 Identities = 77/243 (31%), Positives = 121/243 (49%), Gaps = 2/243 (0%)
 Frame = +3

Query: 39  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMS 218
           MAL+   ++  ++R N C+F ++  FD C  Y SPCSPD+ ++DGWFIC+ H   RFK+ 
Sbjct: 1   MALVSGALSTNRLR-NYCVFGAVQPFDNCRAYGSPCSPDSTNNDGWFICDYHSSIRFKIE 59

Query: 219 KMVLPIFDEDDNNSK*RSLGI*LEIKKEV-SSEF*FQAQPITKRCL-I*TV*CKPNN*SF 392
           KMVLPI D +  N   R++G  L   K + ++      +   K  L + ++       + 
Sbjct: 60  KMVLPIPDAE-GNIYNRTVGKSLVNHKTLGAARVLIPTRDNYKTVLNLNSMSLAEQLVTH 118

Query: 393 I*YITTKRRLTLYATI*NIPKFHKRHATRYTQRLRNYKNILDTTNPNTFCSRVSRDELRF 572
           + Y   + +  +   + +   F                 IL  TNP  +CS+V+ +  R 
Sbjct: 119 MIYDNVEAQGAVCKALQHNENFQTETYRLAEDMFNRTSAILAMTNPRRYCSQVNSNYARI 178

Query: 573 FDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCIIDETGL 752
           +   +       V   +F +   FL+NLI  AVAPE + ID + L  RN  TC ID++GL
Sbjct: 179 WTTDDVN-----VAGNVFESMPPFLKNLINVAVAPEQIMIDEKTLVIRNCPTCNIDDSGL 233

Query: 753 VAS 761
           VA+
Sbjct: 234 VAN 236



 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 30/66 (45%), Positives = 43/66 (65%)
 Frame = +2

Query: 257 FKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICD 436
           +  T+ + LV +K  G  R+LIP+  NY+ V NLNSM  AEQL+ H+IY+N EA   +C 
Sbjct: 73  YNRTVGKSLVNHKTLGAARVLIPTRDNYKTVLNLNSMSLAEQLVTHMIYDNVEAQGAVCK 132

Query: 437 NLKYTE 454
            L++ E
Sbjct: 133 ALQHNE 138


>UniRef50_Q0N423 Cluster: VP39; n=1; Clanis bilineata
           nucleopolyhedrosis virus|Rep: VP39 - Clanis bilineata
           nucleopolyhedrosis virus
          Length = 350

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 41/70 (58%), Positives = 49/70 (70%)
 Frame = +3

Query: 39  MALMPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMS 218
           MAL+  GMA  ++  N CIF S+  FDAC  Y+SPCS DA ++DGW IC+ HL  RFKM 
Sbjct: 1   MALVVSGMATGRIN-NYCIFGSVQPFDACGPYRSPCSDDAKNNDGWLICDYHLSTRFKME 59

Query: 219 KMVLPIFDED 248
           KMVLPI D D
Sbjct: 60  KMVLPIPDAD 69



 Score = 73.3 bits (172), Expect = 7e-12
 Identities = 39/83 (46%), Positives = 50/83 (60%)
 Frame = +3

Query: 510 ILDTTNPNTFCSRVSRDELRFFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQ 689
           I+    PN +CSR    + R + VT+       VG Q+FN    FLQNLI +AV PE +Q
Sbjct: 158 IMAMVTPNRYCSRPLYTDDRIWSVTD----ENNVGGQVFNEMPPFLQNLISKAVGPEIMQ 213

Query: 690 IDTEELRFRNSATCIIDETGLVA 758
           I+ EEL  RN ATC I ++GLVA
Sbjct: 214 IENEELLLRNCATCHITQSGLVA 236



 Score = 59.7 bits (138), Expect = 9e-08
 Identities = 28/63 (44%), Positives = 40/63 (63%)
 Frame = +2

Query: 266 TIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLK 445
           T+AR LV +K  G +RIL+P+  NY  V N+ ++  AEQ IFH+IY N+     IC  L+
Sbjct: 76  TLARSLVNHKAIGDERILVPTKRNYMSVLNILALQLAEQYIFHIIYENDVERERICQMLE 135

Query: 446 YTE 454
            +E
Sbjct: 136 ISE 138


>UniRef50_Q9DWZ8 Cluster: VP39; n=2; Nucleopolyhedrovirus|Rep: VP39
           - Spodoptera litura multicapsid nucleopolyhedrovirus
           (SpltMNPV)
          Length = 302

 Score = 68.1 bits (159), Expect = 3e-10
 Identities = 65/243 (26%), Positives = 107/243 (44%), Gaps = 3/243 (1%)
 Frame = +3

Query: 39  MALMPVGMAPRQMRVNRCIFASI--VSFDACITYKSPCSPDAYHDDGWFICNSHLIKRFK 212
           MAL+  G A  +M+ N CIF  +  + F+ C  Y+SPCS DA  +DG F+C  HL + FK
Sbjct: 1   MALVSGGNANSRMK-NYCIFQGVRPIEFNQCSNYRSPCSDDASQNDGVFMCQYHLSRFFK 59

Query: 213 MSKMVLPIFDEDDNNSK*RSLGI*LEIKKEVSSEF*FQAQPITKRCLI*TV*CKPNN*SF 392
           + K  + I  +       R +G  L      +++          + ++  V   P     
Sbjct: 60  IEKTSIAI-PDGTGQKLYRIVGKSLVSHNARANDRILIPTQENYQAVM-NVSMLPPAERL 117

Query: 393 I*YITTKRRLTLYATI*NIPKFHKRHATRYTQRLRNYK-NILDTTNPNTFCSRVSRDELR 569
           + ++    R T  A I N  +  +   +   + + +    I+  T+P  FCS V+ +++R
Sbjct: 118 VLHLIYNNR-TAAAEICNQLRQQENFRSDVVENVTSMAYRIIQITDPEAFCSVVASNDIR 176

Query: 570 FFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCIIDETG 749
            F      T       + +N+   F++NLI   VAPE L +       +  AT  I   G
Sbjct: 177 SFGNEADLT-------RTYNSLPPFIKNLINTLVAPEVLTLGNNTFPLKACATVSITTNG 229

Query: 750 LVA 758
           L A
Sbjct: 230 LQA 232



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 27/62 (43%), Positives = 38/62 (61%)
 Frame = +2

Query: 269 IARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLKY 448
           + + LV +  R   RILIP+  NYQ V N++ +  AE+L+ HLIYNN  A   IC+ L+ 
Sbjct: 79  VGKSLVSHNARANDRILIPTQENYQAVMNVSMLPPAERLVLHLIYNNRTAAAEICNQLRQ 138

Query: 449 TE 454
            E
Sbjct: 139 QE 140


>UniRef50_Q7T9T4 Cluster: Vp39-capsid; n=5; Granulovirus|Rep:
           Vp39-capsid - Adoxophyes orana granulovirus (AoGV)
          Length = 291

 Score = 60.9 bits (141), Expect = 4e-08
 Identities = 69/241 (28%), Positives = 101/241 (41%), Gaps = 8/241 (3%)
 Frame = +3

Query: 54  VGMAPRQMRVNRCIFASIVS----FDACITYKSPCSPDAYHD--DGWFICNSHLIKRFKM 215
           + + P ++  N CIF  +V     +  C  Y SPCSPDA +   DG FICN HL K FK+
Sbjct: 4   INVGPCELN-NYCIFQGVVGMMPDYYRCENYSSPCSPDASNSNLDGTFICNYHLNKYFKI 62

Query: 216 SKMVLPIFDEDDNNSK*RSLGI*LEIKKEVSSEF*FQAQPITKRCLI*TV*CKPNN*SFI 395
            K    I    DN S    +G  L  + +  +       P+     + T          I
Sbjct: 63  LKSSFRIPSGKDNKSFKMLVGQSLLQQTDNDTNKNKVLIPLDHELYLKTSSRNSVERMII 122

Query: 396 *YI-TTKRRLTLYATI*NIPKFHKRHATRYTQRLRNYKNILDTTNPNTFCSRVSRD-ELR 569
             I   K ++     I    +F ++ A    Q   N   I+   NP+  C R++ + E R
Sbjct: 123 YTIYNDKEKIKDLCDILMKQEFFEQPAWAAFQITLN--TIMGLVNPSMLCERLTTNKENR 180

Query: 570 FFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCIIDETG 749
            F   N  T+        +N +S FL+NLI R V P  + I+   ++  N  TC     G
Sbjct: 181 VF---NNETY--------YNQFSPFLKNLINRLVRPITMTINNYVIKIDNVDTCNFTSDG 229

Query: 750 L 752
           L
Sbjct: 230 L 230


>UniRef50_Q6QXM6 Cluster: ORF086; n=1; Agrotis segetum
           granulovirus|Rep: ORF086 - Agrotis segetum granulosis
           virus (AsGV) (Agrotis segetumgranulovirus)
          Length = 292

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 26/53 (49%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = +3

Query: 84  NRCIFASIV--SFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMSKMVLPI 236
           N CIF  +    F  C  Y+ PC    Y+DDG FIC  HL K FKM KMV+ I
Sbjct: 12  NLCIFQGVQPPEFLNCRPYEPPCI-QPYNDDGTFICQYHLAKYFKMEKMVVRI 63



 Score = 41.5 bits (93), Expect = 0.025
 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 1/92 (1%)
 Frame = +3

Query: 507 NILDTTNPNTFCSRVSRDELRFFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYL 686
           +I+   NP  +C      ++R FD         GV   +F+    FL+NLIR  V P+ +
Sbjct: 152 HIMGLINPAIYCRPEIIRDIRSFD----NPPGNGVQTAVFDQMPPFLKNLIRLTVRPQTM 207

Query: 687 QIDTEELRFRNSATC-IIDETGLVASGPTAPS 779
            +   +L      TC ++ E GLVA+    P+
Sbjct: 208 TVSNTQLLLAQVPTCDLVPERGLVAANLYNPT 239


>UniRef50_Q0ZNY8 Cluster: Major viral capsid protein 39; n=3;
           Nucleopolyhedrovirus|Rep: Major viral capsid protein 39
           - Neodiprion abietis nucleopolyhedrovirus
          Length = 315

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 16/45 (35%), Positives = 33/45 (73%)
 Frame = +2

Query: 311 RILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLK 445
           R+++P+  NY+++F +  +  + QL+FHL+Y N+ A++ IC ++K
Sbjct: 104 RVIVPTRRNYEDIFKVAYLPISYQLVFHLLYQNQSAIDKICQDVK 148


>UniRef50_Q9DVV4 Cluster: PxORF79 peptide; n=1; Plutella xylostella
           granulovirus|Rep: PxORF79 peptide - Plutella xylostella
           granulovirus
          Length = 320

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 3/62 (4%)
 Frame = +3

Query: 60  MAPRQMRV-NRCIFASIVSFDA--CITYKSPCSPDAYHDDGWFICNSHLIKRFKMSKMVL 230
           M+ RQ RV N CIF ++   ++  C      CS DA +DDG FICN HL   F + KM L
Sbjct: 2   MSLRQNRVYNNCIFQAVSYSNSSLCADPVLHCSKDASNDDGTFICNHHLSMYFPLEKMTL 61

Query: 231 PI 236
            I
Sbjct: 62  EI 63



 Score = 37.1 bits (82), Expect = 0.54
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 5/68 (7%)
 Frame = +2

Query: 257 FKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEA-----V 421
           FK+ I + LV  ++   + I+IPS  NY +   +N+M  AE+ I + IY          +
Sbjct: 71  FKLLIGKSLV--QQDATRNIIIPSKANYIDYLRVNNMSPAEKFIMYSIYGESATEPTGLI 128

Query: 422 NVICDNLK 445
             +C++L+
Sbjct: 129 TQLCESLR 136


>UniRef50_Q9PYT2 Cluster: ORF111; n=4; Granulovirus|Rep: ORF111 -
           Xestia c-nigrum granulosis virus (XnGV) (Xestia
           c-nigrumgranulovirus)
          Length = 329

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 24/61 (39%), Positives = 31/61 (50%), Gaps = 2/61 (3%)
 Frame = +3

Query: 84  NRCIFASIV--SFDACITYKSPCSPDAYHDDGWFICNSHLIKRFKMSKMVLPIFDEDDNN 257
           N CIF  +    F  C  Y  PCS D  + DG F+C+ HL + FK+ K V  I    +N 
Sbjct: 16  NLCIFQGVQPPEFMNCGIYTPPCSDDCVNKDGTFVCSYHLARYFKLKKEVFEIPSGVNNT 75

Query: 258 S 260
           S
Sbjct: 76  S 76



 Score = 39.9 bits (89), Expect = 0.076
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 1/84 (1%)
 Frame = +3

Query: 507 NILDTTNPNTFCSRVSRDELRFFDVTNARTHRGGVGDQLFNNYSGFLQNLIRRAVAPEYL 686
           +++    P+  C     + +R F   + R  +     + F     F++NLI R V P  L
Sbjct: 183 SLMGAIKPSIICRPTREETVRTFSSNDNR--QPDENQRAFEAMPNFIKNLIMRLVRPVTL 240

Query: 687 QIDTEELRFRNSATCIID-ETGLV 755
           QI + EL    SATC I+ + GL+
Sbjct: 241 QIGSTELILDQSATCRIEPQQGLI 264



 Score = 34.3 bits (75), Expect = 3.8
 Identities = 16/55 (29%), Positives = 26/55 (47%)
 Frame = +2

Query: 257 FKMTIARHLVGNKERGIKRILIPSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAV 421
           FK  +   L+        RI IP+  NY    N+ +M   E+ +F+ IY+  + V
Sbjct: 77  FKYLVGVSLIQQNVPTANRITIPAKDNYYSYLNVANMSSMEKYVFYSIYDEPDTV 131


>UniRef50_Q8JRX1 Cluster: Capsid protein VP39; n=1; Phthorimaea
           operculella granulovirus|Rep: Capsid protein VP39 -
           Phthorimaea operculella granulovirus
          Length = 293

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 63/231 (27%), Positives = 95/231 (41%), Gaps = 8/231 (3%)
 Frame = +3

Query: 84  NRCIFASI-VSFDACITYKSPCSPDAYHD--DGWFICNSHLIKRFKM--SKMVLPIFDED 248
           N CIF  +   FD C  Y   CS DA +   DG FICN HL K F++  SK  +P    D
Sbjct: 13  NYCIFQGVNYQFD-CDGYTRQCSEDARYSQLDGTFICNFHLGKYFRILKSKFEIPSGGVD 71

Query: 249 DNNSK*RSLGI*LEIKKEVSSEF*FQAQ-PITKRCLI*TV*CKPNN*SFI*YITTKRRLT 425
           + + K   +G  L    E S++   +   P++   +   V  +     F+ Y   +    
Sbjct: 72  NRSFK-MLVGQSLVPYAEKSTDPGKRLLIPMSVDDVRLAVSSRSLMERFVFYTIYEDEDK 130

Query: 426 LYATI*NIPKFHKRHATRYTQRLRNY--KNILDTTNPNTFCSRVSRDELRFFDVTNARTH 599
           L +    I    + ++T  T    N+   +I++   PN           R F    A+  
Sbjct: 131 LKSICDEITNQEEIYSTSDTWESVNFNINSIINMATPN-----------RLFCPPKAKML 179

Query: 600 RGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATCIIDETGL 752
                D+ F     FLQNL++  V P  L+I T  L    + TC   + GL
Sbjct: 180 YSYTSDESFKKLPKFLQNLVQCLVKPVKLEIGTFSLVLETANTCSFTDNGL 230


>UniRef50_A0NRY8 Cluster: Short-chain dehydrogenase/reductase SDR;
           n=1; Stappia aggregata IAM 12614|Rep: Short-chain
           dehydrogenase/reductase SDR - Stappia aggregata IAM
           12614
          Length = 270

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 2/90 (2%)
 Frame = +2

Query: 224 GFAHFRRRRQ*FKMTIARHLVGNKERGIKRILIPSATNY--QEVFNLNSMMQAEQLIFHL 397
           G AH  R+R  F +T    LV    RGI      S   Y  + V    S    E++   +
Sbjct: 8   GKAHPERKRYMFDLTGQVALVTGASRGIGEAAARSLAKYGAKVVLAARSDKDIERIAGEI 67

Query: 398 IYNNEEAVNVICDNLKYTEVSQAARNALYT 487
               ++A  V+CD   Y +V +A + A+ T
Sbjct: 68  RAEGQDATAVVCDVADYDDVVKAVQTAVDT 97


>UniRef50_A5DZG4 Cluster: Guanine nucleotide-binding protein alpha-3
           subunit; n=3; Saccharomycetales|Rep: Guanine
           nucleotide-binding protein alpha-3 subunit -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 539

 Score = 34.7 bits (76), Expect = 2.9
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 3/88 (3%)
 Frame = +3

Query: 486 QRLRNYKNILDTTNPNTFCSRVSRDELRFF---DVTNARTHRGGVGDQLFNNYSGFLQNL 656
           Q + NY+ ILD TN  TF + ++      +   +V     H+ G    L ++   FL NL
Sbjct: 287 QEVLNYEIILDGTNDTTFDAEIASKIEAIYNHPEVKEFMIHKQG-QFYLIDSTEYFLTNL 345

Query: 657 IRRAVAPEYLQIDTEELRFRNSATCIID 740
             R V P+Y+   T+ L  R   + I D
Sbjct: 346 -HRIVQPDYIPSTTDILHTRKKTSGIFD 372


>UniRef50_Q8YXH3 Cluster: Zam protein; n=6; Cyanobacteria|Rep: Zam
           protein - Anabaena sp. (strain PCC 7120)
          Length = 783

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 25/88 (28%), Positives = 44/88 (50%)
 Frame = -2

Query: 274 SDRHFELLSSSSKMGKTIFDILKRLMRWLLQINHPSS*YASGEHGDLYVMHASNDTMDAK 95
           S +  E L + + +G+ I +   RL R  LQ+N PS+     + G L  +  ++  + + 
Sbjct: 386 SPQIIERLQNLTTIGQAIKE--SRLARGSLQLNLPSNQNPYYDEGSLGAVLVNDSPVRSL 443

Query: 94  MQRLTLICRGAIPTGISAILLPL*IWTT 11
           +  L L+    I T +SA+ +P  IW T
Sbjct: 444 LMELVLLVNELIATHLSALGIPA-IWRT 470


>UniRef50_Q5QBL6 Cluster: Cathepsin L; n=1; Culicoides
           sonorensis|Rep: Cathepsin L - Culicoides sonorensis
          Length = 331

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +3

Query: 615 DQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSATC 731
           ++L  N  G+++  +RR +APE    DT+++  +N A C
Sbjct: 99  NELMTNADGWIEKPLRRQLAPESYAWDTKDVPVKNQAQC 137


>UniRef50_Q8PX46 Cluster: Exopolyphosphatase; n=4;
           Methanosarcina|Rep: Exopolyphosphatase - Methanosarcina
           mazei (Methanosarcina frisia)
          Length = 543

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 14/53 (26%), Positives = 30/53 (56%)
 Frame = -2

Query: 814 FHDVTASYRVVQLGAVGPDATRPVSSIIHVALFLNLNSSVSICKYSGATARRI 656
           F +++ +YRV ++ AV   ATR  S+ + +   +   +++ +C  SG+   R+
Sbjct: 72  FMELSRAYRVEEIIAVATSATRDASNKVQLLEMIKKEANLEVCTISGSEEARL 124


>UniRef50_P26591 Cluster: Glutamate receptor precursor; n=5;
           Mollusca|Rep: Glutamate receptor precursor - Lymnaea
           stagnalis (Great pond snail)
          Length = 917

 Score = 33.1 bits (72), Expect = 8.7
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%)
 Frame = +3

Query: 447 IPKFHKRHATRYTQRLRNYKNILDTTN----PNTFCSRVSRDELRFFDVTNA 590
           I  F++ ++  Y  +L+N   ILD T+     N  C  +SR +L  F V+NA
Sbjct: 45  IHMFNRAYSHVYRYKLKNDTTILDVTDSFAVSNALCHHLSRGDLAIFGVSNA 96


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 830,729,452
Number of Sequences: 1657284
Number of extensions: 16365963
Number of successful extensions: 41566
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 39930
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41548
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 71734006925
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -