SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120028.Seq
         (721 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P41423 Cluster: Uncharacterized 38.7 kDa protein in PK1...   175   7e-43
UniRef50_Q65361 Cluster: Uncharacterized 36.6 kDa protein; n=7; ...    82   1e-14
UniRef50_Q65341 Cluster: LEF-Autographa californica nuclear poly...    76   8e-13
UniRef50_Q65342 Cluster: LEF-Autographa californica nuclear poly...    61   3e-08
UniRef50_Q65343 Cluster: Lef-1 protein; n=1; Autographa californ...    55   2e-06
UniRef50_A1YJ07 Cluster: 38.7 kDa protein; n=6; Nucleopolyhedrov...    42   0.020
UniRef50_Q0IKX0 Cluster: 38.7 kDa protein; n=1; Leucania separat...    38   0.25 
UniRef50_Q0N3Y0 Cluster: 38.7K protein; n=1; Clanis bilineata nu...    36   0.76 
UniRef50_Q8IHV6 Cluster: Putative uncharacterized protein; n=4; ...    35   2.3  
UniRef50_A7Q0I5 Cluster: Chromosome chr7 scaffold_42, whole geno...    34   4.1  
UniRef50_A5AZS4 Cluster: Putative uncharacterized protein; n=1; ...    34   4.1  
UniRef50_A2FQ08 Cluster: Viral A-type inclusion protein, putativ...    34   4.1  
UniRef50_UPI00006CCFFA Cluster: hypothetical protein TTHERM_0018...    33   5.4  
UniRef50_Q8XP46 Cluster: Two-component response regulator; n=3; ...    33   5.4  
UniRef50_Q7PTK1 Cluster: ENSANGP00000006278; n=1; Anopheles gamb...    33   5.4  
UniRef50_A0BWZ8 Cluster: Chromosome undetermined scaffold_133, w...    33   5.4  
UniRef50_A0CY94 Cluster: Chromosome undetermined scaffold_31, wh...    33   7.1  
UniRef50_Q6MFH6 Cluster: Related to nucleoprotein TPR; n=3; Sord...    33   7.1  
UniRef50_UPI00006CD2A3 Cluster: hypothetical protein TTHERM_0026...    33   9.4  

>UniRef50_P41423 Cluster: Uncharacterized 38.7 kDa protein in
           PK1-LEF1 intergenic region; n=5;
           Nucleopolyhedrovirus|Rep: Uncharacterized 38.7 kDa
           protein in PK1-LEF1 intergenic region - Autographa
           californica nuclear polyhedrosis virus (AcMNPV)
          Length = 327

 Score =  175 bits (427), Expect = 7e-43
 Identities = 79/91 (86%), Positives = 84/91 (92%)
 Frame = +1

Query: 250 KIYNVIDFCKGLEIAHDDILDCNWDSDQVYHLNEIIFHKQKSKRDLNSLGALFATKQGLL 429
           K YNVIDFCKGLEIAHDDILDCNWD DQVYHLNEI+FHKQ+SKRDLNSLGALFATK GLL
Sbjct: 69  KCYNVIDFCKGLEIAHDDILDCNWDGDQVYHLNEIVFHKQRSKRDLNSLGALFATKHGLL 128

Query: 430 KILMRLNFDNKSNALLHLQTEGERDDCATKL 522
           +ILMRLNF NKSNALLH+QTEGERDD   K+
Sbjct: 129 EILMRLNFANKSNALLHIQTEGERDDLRDKI 159



 Score =  138 bits (334), Expect = 1e-31
 Identities = 66/71 (92%), Positives = 69/71 (97%)
 Frame = +3

Query: 507 LRDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKL 686
           LRDKIESVLKHVKKLN NSEKFMVTHETFKN+VGNRFEQFELRL+ELDAKLNMLQSAEKL
Sbjct: 155 LRDKIESVLKHVKKLNANSEKFMVTHETFKNEVGNRFEQFELRLHELDAKLNMLQSAEKL 214

Query: 687 KTAIVTESKNG 719
           KTA+V ESKNG
Sbjct: 215 KTAVVAESKNG 225



 Score = 96.3 bits (229), Expect = 7e-19
 Identities = 40/45 (88%), Positives = 42/45 (93%)
 Frame = +2

Query: 119 RFDPDDYKKYHINVQQ*SHIVKWDSFKCNTHSFKYRYVHNDTNAK 253
           RF+ DDYKKYHIN QQ SHIVKWDSFKCNTHSFKYRYVH+DTNAK
Sbjct: 25  RFNADDYKKYHINAQQWSHIVKWDSFKCNTHSFKYRYVHSDTNAK 69


>UniRef50_Q65361 Cluster: Uncharacterized 36.6 kDa protein; n=7;
           Nucleopolyhedrovirus|Rep: Uncharacterized 36.6 kDa
           protein - Orgyia pseudotsugata multicapsid polyhedrosis
           virus (OpMNPV)
          Length = 320

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 40/63 (63%), Positives = 47/63 (74%)
 Frame = +3

Query: 507 LRDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKL 686
           L DKIE+VL HVK LNTNS+KF+  H++FK +VG RFEQFE RL  LD KLN LQ A   
Sbjct: 149 LLDKIEAVLNHVKTLNTNSDKFISAHKSFKLEVGARFEQFEQRLQTLDTKLNALQCAAPT 208

Query: 687 KTA 695
           +TA
Sbjct: 209 RTA 211



 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 35/82 (42%), Positives = 54/82 (65%)
 Frame = +1

Query: 259 NVIDFCKGLEIAHDDILDCNWDSDQVYHLNEIIFHKQKSKRDLNSLGALFATKQGLLKIL 438
           +V+DFCKGL+I+HD +  CN+D   V  LNE++     ++ D  SLG+LFATK GL+++L
Sbjct: 66  SVVDFCKGLKISHDLLQRCNFDRQHVRQLNELVLGAPPAQPD--SLGSLFATKHGLVQLL 123

Query: 439 MRLNFDNKSNALLHLQTEGERD 504
            + +F NK+  LL +    + D
Sbjct: 124 QQFSFANKNEVLLAVGANKDHD 145



 Score = 39.9 bits (89), Expect = 0.062
 Identities = 19/57 (33%), Positives = 33/57 (57%)
 Frame = +2

Query: 122 FDPDDYKKYHINVQQ*SHIVKWDSFKCNTHSFKYRYVHNDTNAKSTM**IFAKVLKL 292
           FD   Y++Y ++ +  S +V+ D F+C+   FK+RYV ++T  +      F K LK+
Sbjct: 20  FDEQAYRRYAVDQRAHSDLVRRDVFRCHPFVFKFRYVLDETAGRCCSVVDFCKGLKI 76


>UniRef50_Q65341 Cluster: LEF-Autographa californica nuclear
           polyhedrosis virus late expression factor (lef-1) gene
           and ecdysteroid UDP-glucosyltransferase genes,; n=1;
           Autographa californica nucleopolyhedrovirus|Rep:
           LEF-Autographa californica nuclear polyhedrosis virus
           late expression factor (lef-1) gene and ecdysteroid
           UDP-glucosyltransferase genes, - Autographa californica
           nuclear polyhedrosis virus (AcMNPV)
          Length = 60

 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 40/52 (76%), Positives = 40/52 (76%)
 Frame = -1

Query: 664 MLSLASSSFKRNSNCSNLLPTSFLNVSWVTINXXXXXXXXXXXFKTDSILSR 509
           MLSLASSS KRNSNCSNLLPTSFLNVSWVTIN           FKTDSILSR
Sbjct: 1   MLSLASSSCKRNSNCSNLLPTSFLNVSWVTINFSLFAFSFFTCFKTDSILSR 52


>UniRef50_Q65342 Cluster: LEF-Autographa californica nuclear
           polyhedrosis virus late expression factor (lef-1) gene
           and ecdysteroid UDP-glucosyltransferase genes,; n=1;
           Autographa californica nucleopolyhedrovirus|Rep:
           LEF-Autographa californica nuclear polyhedrosis virus
           late expression factor (lef-1) gene and ecdysteroid
           UDP-glucosyltransferase genes, - Autographa californica
           nuclear polyhedrosis virus (AcMNPV)
          Length = 50

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 29/31 (93%), Positives = 30/31 (96%)
 Frame = -2

Query: 342 MVNLIAVPIAIKYVVVRNFKTFAKIYYIVDF 250
           MVNLIAVPIAIKYVVVRNFKTFAKIY+IV F
Sbjct: 1   MVNLIAVPIAIKYVVVRNFKTFAKIYHIVAF 31


>UniRef50_Q65343 Cluster: Lef-1 protein; n=1; Autographa
          californica nucleopolyhedrovirus|Rep: Lef-1 protein -
          Autographa californica nuclear polyhedrosis virus
          (AcMNPV)
          Length = 50

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = -2

Query: 72 PDHIHQFHNQDSIALICLAIPLLY 1
          PDHIHQFHNQDSIAL CLAIPLLY
Sbjct: 8  PDHIHQFHNQDSIALACLAIPLLY 31


>UniRef50_A1YJ07 Cluster: 38.7 kDa protein; n=6;
           Nucleopolyhedrovirus|Rep: 38.7 kDa protein - Spodoptera
           frugiperda nuclear polyhedrosis virus (SfNPV)
          Length = 384

 Score = 41.5 bits (93), Expect = 0.020
 Identities = 19/58 (32%), Positives = 35/58 (60%)
 Frame = +3

Query: 513 DKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKL 686
           +K+  VL  V  +  ++ + + T++ FK  V  RFE F ++++EL  K+NML + + L
Sbjct: 172 EKLSKVLAAVDTIKEHNSEVVRTNDEFKTQVIERFEWFNVQISELHNKVNMLNNVDDL 229


>UniRef50_Q0IKX0 Cluster: 38.7 kDa protein; n=1; Leucania separata
           nuclear polyhedrosis virus|Rep: 38.7 kDa protein -
           Leucania separata nuclear polyhedrosis virus (LsNPV)
          Length = 382

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 20/56 (35%), Positives = 32/56 (57%)
 Frame = +3

Query: 519 IESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKL 686
           ++++L HV++L  ++E     +E FK     RFE FE RL+EL  +L   +  E L
Sbjct: 175 LQNILDHVQELRRDNETNAKLNEQFKFKALERFEDFEKRLDELRTRLISSEHIEVL 230


>UniRef50_Q0N3Y0 Cluster: 38.7K protein; n=1; Clanis bilineata
           nucleopolyhedrosis virus|Rep: 38.7K protein - Clanis
           bilineata nucleopolyhedrosis virus
          Length = 392

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 19/77 (24%), Positives = 45/77 (58%), Gaps = 7/77 (9%)
 Frame = +3

Query: 507 LRDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRF-------EQFELRLNELDAKLNM 665
           +  K+ +++++++K N   +  + T++ FKN++ N+F       E FE +L +++ K+++
Sbjct: 170 IEQKLATMMEYIEKCN---KTLVDTNQCFKNEIINKFSVLDTKIENFENQLKQVNEKIDL 226

Query: 666 LQSAEKLKTAIVTESKN 716
           L + E+L   +    KN
Sbjct: 227 LNNVEQLYQTLKEHHKN 243


>UniRef50_Q8IHV6 Cluster: Putative uncharacterized protein; n=4;
           Plasmodium|Rep: Putative uncharacterized protein -
           Plasmodium falciparum (isolate 3D7)
          Length = 1794

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 19/78 (24%), Positives = 40/78 (51%)
 Frame = +1

Query: 256 YNVIDFCKGLEIAHDDILDCNWDSDQVYHLNEIIFHKQKSKRDLNSLGALFATKQGLLKI 435
           Y++I+  K   I HD  +D N +  ++Y+ + +I+ K     D+  +   + T+Q ++ +
Sbjct: 485 YSLIELHKIFFILHDKSIDINDEWKEIYYYSVMIYMKVLKNEDIKKVIECYNTEQIIISL 544

Query: 436 LMRLNFDNKSNALLHLQT 489
           L  +N     + LL  +T
Sbjct: 545 LRIMNEFLLKDILLQKKT 562


>UniRef50_A7Q0I5 Cluster: Chromosome chr7 scaffold_42, whole genome
            shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
            chr7 scaffold_42, whole genome shotgun sequence - Vitis
            vinifera (Grape)
          Length = 1113

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 18/65 (27%), Positives = 36/65 (55%)
 Frame = -2

Query: 414  GREQCAQRVEIAFGFLLVKNNFV*MVNLIAVPIAIKYVVVRNFKTFAKIYYIVDFAFVSL 235
            G ++ A+   + + FL+V    + M+N+IA+ + +   +   F  ++K+   V F+F  L
Sbjct: 1000 GDDEFAELYVVKWSFLMVPPITIMMINMIAIAVGVARTLYSTFPQWSKLVGGVFFSFWVL 1059

Query: 234  CTYLY 220
            C +LY
Sbjct: 1060 C-HLY 1063


>UniRef50_A5AZS4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 409

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 18/65 (27%), Positives = 36/65 (55%)
 Frame = -2

Query: 414 GREQCAQRVEIAFGFLLVKNNFV*MVNLIAVPIAIKYVVVRNFKTFAKIYYIVDFAFVSL 235
           G ++ A+   + + FL+V    + M+N+IA+ + +   +   F  ++K+   V F+F  L
Sbjct: 296 GDDEFAELYVVKWSFLMVPPITIMMINMIAIAVGVARTLYSTFPQWSKLVGGVFFSFWVL 355

Query: 234 CTYLY 220
           C +LY
Sbjct: 356 C-HLY 359


>UniRef50_A2FQ08 Cluster: Viral A-type inclusion protein, putative;
           n=1; Trichomonas vaginalis G3|Rep: Viral A-type
           inclusion protein, putative - Trichomonas vaginalis G3
          Length = 2271

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = +3

Query: 564 EKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEK 683
           E  +   ET K+D+ N+    + +LNEL  K N L  A+K
Sbjct: 73  EDELTESETSKDDLSNKLNDLQKKLNELQKKANQLDQAKK 112


>UniRef50_UPI00006CCFFA Cluster: hypothetical protein
           TTHERM_00189200; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00189200 - Tetrahymena
           thermophila SB210
          Length = 875

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 16/40 (40%), Positives = 24/40 (60%)
 Frame = +3

Query: 591 FKNDVGNRFEQFELRLNELDAKLNMLQSAEKLKTAIVTES 710
           F +   N   QF +++NE   +LN +QS EKL  +I +ES
Sbjct: 708 FNSQQKNNNNQFNIQVNENFPRLNSIQSEEKLNQSIFSES 747


>UniRef50_Q8XP46 Cluster: Two-component response regulator; n=3;
           Clostridium perfringens|Rep: Two-component response
           regulator - Clostridium perfringens
          Length = 226

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 2/64 (3%)
 Frame = +1

Query: 238 RHERKIYNVIDFCKGLEIAHDDILDCNWDSDQVYHLNEIIFHKQKSKRDLNSLGA--LFA 411
           ++E KI N++   KG  ++ D+I+   W S++    N +  +  + +R +  +GA     
Sbjct: 157 KNESKILNILIRNKGKIVSRDNIIKALWQSNEFIDDNTLTVNVNRLRRKIEGIGAEGYLQ 216

Query: 412 TKQG 423
           TK+G
Sbjct: 217 TKRG 220


>UniRef50_Q7PTK1 Cluster: ENSANGP00000006278; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000006278 - Anopheles gambiae
           str. PEST
          Length = 495

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +3

Query: 552 NTNSEKFMVTHETFKNDVGNRFEQFELR-LNELDAKLNMLQSAEKLKTAIVTESK 713
           N N+    + +  F+ND  + F+  ELR +N+LD    +L+    L +   TE +
Sbjct: 170 NNNNNYNKINYSDFENDTSSPFDNMELRTINDLDILAQVLKQNTTLSSPATTEQR 224


>UniRef50_A0BWZ8 Cluster: Chromosome undetermined scaffold_133,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_133,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 334

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +3

Query: 507 LRDKIESVLKHV-KKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAE 680
           L++ IE  L++V KK+  +  + +  HE  + D  N    F  +L+E+D +L   Q+ E
Sbjct: 91  LQEGIERCLRNVSKKIEESKNQLIQQHERLREDKENERMNFVAQLSEVDERLRTSQNLE 149


>UniRef50_A0CY94 Cluster: Chromosome undetermined scaffold_31, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_31,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 594

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 19/70 (27%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = +3

Query: 507 LRDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEK- 683
           ++D+I+ + + +K+   N E F          +  +F+QF+   NELD KL  L   +K 
Sbjct: 403 IQDQIDQLKQQLKEEEQNLESFKQNKAQEIQGLEEKFKQFQFDNNELDKKLAQLNIQKKE 462

Query: 684 LKTAIVTESK 713
           L++ +  ++K
Sbjct: 463 LQSQLEQQNK 472


>UniRef50_Q6MFH6 Cluster: Related to nucleoprotein TPR; n=3;
           Sordariomycetes|Rep: Related to nucleoprotein TPR -
           Neurospora crassa
          Length = 2115

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 2/110 (1%)
 Frame = +3

Query: 369 EIQTRSQLVGRIVRDQAGVVENFDAVKF*QQKQRVAAPSN*RRA**LRDKIESVLKHVKK 548
           E+Q ++Q + R+VRD A  +EN +A+    +KQ+ A      +   LR  + ++   VK 
Sbjct: 556 ELQEKNQELLRVVRDLADKMENEEAM---AEKQQAAQDHEEVQQ--LRLVVTTLQDEVKS 610

Query: 549 LNTNSEKFMVTHETFKNDVGNRFEQFELR--LNELDAKLNMLQSAEKLKT 692
           +    + +M   + F+  +  R    E+R  L E  ++  +L S E+  T
Sbjct: 611 ITVRMKSYMTERDMFRRMLQQRANPAEIRAALGEDVSQREVLTSIEQNST 660


>UniRef50_UPI00006CD2A3 Cluster: hypothetical protein
           TTHERM_00266460; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00266460 - Tetrahymena
           thermophila SB210
          Length = 1341

 Score = 32.7 bits (71), Expect = 9.4
 Identities = 15/58 (25%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = +3

Query: 546 KLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDA-KLNMLQSAEKLKTAIVTESKN 716
           K N +++   ++   FKN + +  EQ ++ +++LD+ K   L+ +  LK  ++ + KN
Sbjct: 541 KHNNSNKNSQISESYFKNQISSFGEQDQINIDDLDSFKSQKLEDSNSLKGQLLQKQKN 598


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 593,908,070
Number of Sequences: 1657284
Number of extensions: 10753280
Number of successful extensions: 33203
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 31759
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33172
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 58264468239
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -