SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120017.Seq
         (731 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P32651 Cluster: Structural glycoprotein gp41; n=34; Nuc...   167   2e-40
UniRef50_A0EYW6 Cluster: Gp41; n=1; Ecotropis obliqua NPV|Rep: G...    91   2e-17
UniRef50_Q6QXL5 Cluster: ORF95; n=9; Granulovirus|Rep: ORF95 - A...    52   1e-05
UniRef50_Q9DVU6 Cluster: PxORF87 peptide; n=1; Plutella xylostel...    48   3e-04
UniRef50_Q7T9S7 Cluster: Gp41; n=1; Adoxophyes orana granuloviru...    48   3e-04
UniRef50_UPI000023E59A Cluster: hypothetical protein FG10166.1; ...    42   0.021
UniRef50_A0BXE7 Cluster: Chromosome undetermined scaffold_134, w...    40   0.063
UniRef50_UPI0000DB7249 Cluster: PREDICTED: similar to CG10936-PA...    37   0.44 
UniRef50_Q0U7A9 Cluster: Putative uncharacterized protein; n=1; ...    37   0.44 
UniRef50_Q4ZZL7 Cluster: Putative uncharacterized protein; n=1; ...    37   0.59 
UniRef50_Q4Q5K8 Cluster: Putative uncharacterized protein; n=3; ...    37   0.59 
UniRef50_A6S277 Cluster: Putative uncharacterized protein; n=2; ...    37   0.59 
UniRef50_UPI00015B6434 Cluster: PREDICTED: similar to daughterle...    36   0.77 
UniRef50_A0TBY9 Cluster: Putative uncharacterized protein; n=2; ...    36   0.77 
UniRef50_UPI0000DB70E7 Cluster: PREDICTED: similar to LSY-2-Like...    36   1.0  
UniRef50_Q06I87 Cluster: Fasciclin-like protein FLA19; n=1; Trit...    36   1.0  
UniRef50_Q92793 Cluster: CREB-binding protein; n=64; Euteleostom...    36   1.0  
UniRef50_A7F2U2 Cluster: Predicted protein; n=1; Sclerotinia scl...    35   1.8  
UniRef50_A7EDH7 Cluster: Putative uncharacterized protein; n=1; ...    35   1.8  
UniRef50_UPI0000DB7668 Cluster: PREDICTED: similar to CG14073-PA...    35   2.4  
UniRef50_Q4QDP4 Cluster: Putative uncharacterized protein; n=3; ...    35   2.4  
UniRef50_Q07283 Cluster: Trichohyalin; n=9; Eukaryota|Rep: Trich...    35   2.4  
UniRef50_Q9YMJ3 Cluster: LdOrf-134 peptide; n=1; Lymantria dispa...    34   3.1  
UniRef50_Q54YJ4 Cluster: Putative uncharacterized protein; n=1; ...    34   3.1  
UniRef50_Q9RZD6 Cluster: Ferredoxin-nitrite reductase; n=2; Dein...    34   4.1  
UniRef50_A0DR04 Cluster: Chromosome undetermined scaffold_6, who...    34   4.1  
UniRef50_A6RA09 Cluster: Predicted protein; n=1; Ajellomyces cap...    34   4.1  
UniRef50_UPI00015B5277 Cluster: PREDICTED: similar to ENSANGP000...    33   5.5  
UniRef50_Q9CFD3 Cluster: Putative uncharacterized protein ypiL; ...    33   5.5  
UniRef50_Q8F0H1 Cluster: Putative uncharacterized protein; n=4; ...    33   5.5  
UniRef50_Q8WS39 Cluster: Similar to adenomatous polyposis; n=1; ...    33   5.5  
UniRef50_Q54MY9 Cluster: Protein serine/threonine kinase; n=2; D...    33   5.5  
UniRef50_Q54MR8 Cluster: RING Zn finger-containing protein; n=1;...    33   5.5  
UniRef50_A7S830 Cluster: Predicted protein; n=16; Nematostella v...    33   5.5  
UniRef50_Q2HGB0 Cluster: Putative uncharacterized protein; n=2; ...    33   5.5  
UniRef50_A6RQS8 Cluster: Predicted protein; n=1; Botryotinia fuc...    33   5.5  
UniRef50_Q9V8R9 Cluster: Protein 4.1 homolog; n=6; Sophophora|Re...    33   5.5  
UniRef50_Q7R506 Cluster: GLP_137_65224_61523; n=1; Giardia lambl...    33   7.2  
UniRef50_Q54WE6 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_Q54M27 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_Q5KNU5 Cluster: IDN3-B, putative; n=2; Filobasidiella n...    33   7.2  
UniRef50_A7TI39 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_A5E1X0 Cluster: Predicted protein; n=1; Lodderomyces el...    33   7.2  
UniRef50_A4RD94 Cluster: Putative uncharacterized protein; n=1; ...    33   7.2  
UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein...    33   7.2  
UniRef50_UPI00015B4A0A Cluster: PREDICTED: similar to CG11290-PA...    33   9.5  
UniRef50_Q54P98 Cluster: Ras interacting protein; n=2; Dictyoste...    33   9.5  
UniRef50_A7RZW0 Cluster: Predicted protein; n=2; Nematostella ve...    33   9.5  

>UniRef50_P32651 Cluster: Structural glycoprotein gp41; n=34;
           Nucleopolyhedrovirus|Rep: Structural glycoprotein gp41 -
           Autographa californica nuclear polyhedrosis virus
           (AcMNPV)
          Length = 409

 Score =  167 bits (406), Expect = 2e-40
 Identities = 80/86 (93%), Positives = 82/86 (95%)
 Frame = +3

Query: 252 QCVDFVQKIIRYYRCNDMSELSPLMIHFINTIRDMCIDTNPINVNVVKRFESEETMIRHL 431
           +CVDFVQKIIRYYRCNDMSELSPLMI FINTIRDMCIDTNPI+VNVVKRFESEETMIRHL
Sbjct: 90  KCVDFVQKIIRYYRCNDMSELSPLMILFINTIRDMCIDTNPISVNVVKRFESEETMIRHL 149

Query: 432 IRLQKELGQGNAAESLPSDSNIFQAS 509
           IRLQKELGQ NAAESL SDSNIFQ S
Sbjct: 150 IRLQKELGQSNAAESLSSDSNIFQPS 175



 Score =  155 bits (376), Expect = 1e-36
 Identities = 79/101 (78%), Positives = 84/101 (83%), Gaps = 8/101 (7%)
 Frame = +1

Query: 4   MTDERGNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTT-------RDNKMD-T 159
           MTDERGNFYYNTPPP LRYPSNPATAIFT+AQTYN APGYVPP T       RDN+MD T
Sbjct: 1   MTDERGNFYYNTPPP-LRYPSNPATAIFTSAQTYN-APGYVPPATVPTTVATRDNRMDYT 58

Query: 160 SRSNSTNSVAIAPYNKSKEPTLDAGESIWYNNVWILFKKLL 282
           SRSNSTNSVAIAPYNKSKEPTLDAGESIWYN      +K++
Sbjct: 59  SRSNSTNSVAIAPYNKSKEPTLDAGESIWYNKCVDFVQKII 99



 Score =  153 bits (370), Expect = 6e-36
 Identities = 72/74 (97%), Positives = 73/74 (98%)
 Frame = +2

Query: 509 FVLNSLPAYAQKFYNGGADMLGKDALAEAGKQLSLAVQYMVAESVTCNIPIPLPFNQQLA 688
           FVLNSLPAYAQKFYNGGADMLGKDALAEA KQLSLAVQYMVAE+VTCNIPIPLPFNQQLA
Sbjct: 176 FVLNSLPAYAQKFYNGGADMLGKDALAEAAKQLSLAVQYMVAEAVTCNIPIPLPFNQQLA 235

Query: 689 NNYMTLLLKHATLP 730
           NNYMTLLLKHATLP
Sbjct: 236 NNYMTLLLKHATLP 249


>UniRef50_A0EYW6 Cluster: Gp41; n=1; Ecotropis obliqua NPV|Rep: Gp41
           - Ecotropis obliqua NPV
          Length = 338

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 41/74 (55%), Positives = 56/74 (75%)
 Frame = +2

Query: 509 FVLNSLPAYAQKFYNGGADMLGKDALAEAGKQLSLAVQYMVAESVTCNIPIPLPFNQQLA 688
           F+ + LP+YAQKFYN G   +  ++ +EA KQL LA+QY +A+SVT ++PIPLP  QQL 
Sbjct: 112 FMEHILPSYAQKFYNKGNFEVSNNSKSEAAKQLGLAIQYQIAQSVTSSVPIPLPLTQQLV 171

Query: 689 NNYMTLLLKHATLP 730
           NN++TLLLK A +P
Sbjct: 172 NNFITLLLKKAQIP 185



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 34/68 (50%), Positives = 48/68 (70%)
 Frame = +3

Query: 252 QCVDFVQKIIRYYRCNDMSELSPLMIHFINTIRDMCIDTNPINVNVVKRFESEETMIRHL 431
           QCV+  Q II+Y+R ND S  +   IH +NTIRD+CID NP+N+NVVKRF+S+E ++++ 
Sbjct: 33  QCVNLDQ-IIKYFRTNDHSGFNQETIHLVNTIRDICIDANPLNINVVKRFDSDEALMKNY 91

Query: 432 IRLQKELG 455
             L    G
Sbjct: 92  ENLVLRAG 99


>UniRef50_Q6QXL5 Cluster: ORF95; n=9; Granulovirus|Rep: ORF95 -
           Agrotis segetum granulosis virus (AsGV) (Agrotis
           segetumgranulovirus)
          Length = 309

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 22/60 (36%), Positives = 39/60 (65%)
 Frame = +3

Query: 276 IIRYYRCNDMSELSPLMIHFINTIRDMCIDTNPINVNVVKRFESEETMIRHLIRLQKELG 455
           +I  YR N+ ++L+P  I  +N +RD+ +   P+ V+V KRFE++E +I +   L+K+ G
Sbjct: 31  MINMYRSNNTAKLTPEQIACLNLVRDLFLQAEPLPVSVTKRFETDEELINYYKNLEKKYG 90



 Score = 33.1 bits (72), Expect = 7.2
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = +2

Query: 509 FVLNSL-PAYAQKFYNGGADMLGKDALAEAGKQLSLAVQYMVAESVTCNIPIPLPFNQQL 685
           FV++ +  AYA KFY        K  L  A   LS  V+Y +A +VT + P+P+  N  +
Sbjct: 107 FVISPIMKAYADKFY--------KRRLNVAASHLSDVVKYQMANAVTHSKPLPIVHN-DV 157

Query: 686 ANNYMTLLLKH 718
           A+ Y+   LKH
Sbjct: 158 ADEYLN-TLKH 167


>UniRef50_Q9DVU6 Cluster: PxORF87 peptide; n=1; Plutella xylostella
           granulovirus|Rep: PxORF87 peptide - Plutella xylostella
           granulovirus
          Length = 283

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 28/83 (33%), Positives = 39/83 (46%)
 Frame = +3

Query: 267 VQKIIRYYRCNDMSELSPLMIHFINTIRDMCIDTNPINVNVVKRFESEETMIRHLIRLQK 446
           +  +I  YR ND S L+   I  IN IRD  I  +P+ V V KRFE++  +I +   L K
Sbjct: 9   ITNMINMYRNNDTSNLNAEEIAAINLIRDTFIKADPLPVTVTKRFENDNQLIDYYKNLDK 68

Query: 447 ELGQGNAAESLPSDSNIFQASLC 515
           +       E     +  F  S C
Sbjct: 69  KYVNAEVDEGRSIFNKTFLISPC 91


>UniRef50_Q7T9S7 Cluster: Gp41; n=1; Adoxophyes orana
           granulovirus|Rep: Gp41 - Adoxophyes orana granulovirus
           (AoGV)
          Length = 289

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 20/58 (34%), Positives = 37/58 (63%)
 Frame = +3

Query: 276 IIRYYRCNDMSELSPLMIHFINTIRDMCIDTNPINVNVVKRFESEETMIRHLIRLQKE 449
           II  YR N+ ++L P  I  +NT+RD+ +  +P+ V   KRFE+++ ++ +   L+K+
Sbjct: 12  IINSYRINNTAKLKPEQILCLNTVRDLFLKADPLPVTATKRFENDKELLSYYGNLEKK 69



 Score = 34.7 bits (76), Expect = 2.4
 Identities = 22/64 (34%), Positives = 31/64 (48%)
 Frame = +2

Query: 530 AYAQKFYNGGADMLGKDALAEAGKQLSLAVQYMVAESVTCNIPIPLPFNQQLANNYMTLL 709
           +YA KFYN   ++        A   L   ++YM+A S+T N P+PL       N Y+ LL
Sbjct: 95  SYADKFYNRRLNL--------AAAHLGDVLKYMIAYSITNNKPLPLLNLDSTTNEYLKLL 146

Query: 710 LKHA 721
              A
Sbjct: 147 YHKA 150


>UniRef50_UPI000023E59A Cluster: hypothetical protein FG10166.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG10166.1 - Gibberella zeae PH-1
          Length = 608

 Score = 41.5 bits (93), Expect = 0.021
 Identities = 19/60 (31%), Positives = 33/60 (55%)
 Frame = +1

Query: 46  PPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTL 225
           P  R  S PA  +  NAQTY   P  +PPTT  ++   + S+    ++ +P  K+++P++
Sbjct: 431 PQPRNDSTPAHDLALNAQTYLPPPPPIPPTTERHRPPRAPSSGARHLSCSPIRKTRQPSI 490


>UniRef50_A0BXE7 Cluster: Chromosome undetermined scaffold_134,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_134,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 709

 Score = 39.9 bits (89), Expect = 0.063
 Identities = 28/116 (24%), Positives = 56/116 (48%), Gaps = 1/116 (0%)
 Frame = +3

Query: 105 QQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCVDFVQKIIR 284
           QQ+ + +     +QQ   + QQQ +    +  QQ+Q+   ++++  +VQ+CVD     ++
Sbjct: 365 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLIVQECVDQNSTNVQ 424

Query: 285 YYRCNDMSELSPLMIHFINTIRDMCIDTNPINVNVVKRFESEETMIRHLIR-LQKE 449
               + ++E     I  I+  +      +  + N +++ + EET   H  R LQKE
Sbjct: 425 STLTDTITEEDTQQIQIIDNSQSQVEKQDKSDKNNLEQEQKEETHHIHKHRNLQKE 480


>UniRef50_UPI0000DB7249 Cluster: PREDICTED: similar to CG10936-PA,
           isoform A; n=1; Apis mellifera|Rep: PREDICTED: similar
           to CG10936-PA, isoform A - Apis mellifera
          Length = 1173

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 23/68 (33%), Positives = 32/68 (47%)
 Frame = +3

Query: 402 ESEETMIRHLIRLQKELGQGNAAESLPSDSNIFQASLC*IRCRRTRKNFTTVALICWVKT 581
           ES E++   L R+Q EL  G  A    +  N  Q  +   R R TR+ +TT A    +  
Sbjct: 405 ESTESVSDKLDRVQSELSNGFLAGGFRTAGNTLQLDVLNERDRNTRRRYTTTAKTPVINK 464

Query: 582 LWPRRANN 605
             PRR N+
Sbjct: 465 FVPRRYND 472


>UniRef50_Q0U7A9 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 410

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 1/61 (1%)
 Frame = +1

Query: 37  TP-PPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSK 213
           TP P P   P +P   IFT   T++NA  Y P  +  +       N  N+  +A +N S 
Sbjct: 49  TPVPSPTEDPEDPPAPIFTGVDTFDNATVYQPDDSTHHLTSPRTENLPNNTILAVWNDSA 108

Query: 214 E 216
           +
Sbjct: 109 Q 109


>UniRef50_Q4ZZL7 Cluster: Putative uncharacterized protein; n=1;
           Pseudomonas syringae pv. syringae B728a|Rep: Putative
           uncharacterized protein - Pseudomonas syringae pv.
           syringae (strain B728a)
          Length = 393

 Score = 36.7 bits (81), Expect = 0.59
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +3

Query: 174 HKLG-SDRTVQQEQRTDARRRRIYLVQQCVDFVQKIIRYYRCNDMSELSPLMIHF 335
           H+ G SDR +   Q    +R R YL QQCV  V +++     + +   +PL  H+
Sbjct: 303 HEAGLSDRVLDAAQLLQLKRDRAYLAQQCVQAVHRLVERLGASSLVASNPLQRHW 357


>UniRef50_Q4Q5K8 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 389

 Score = 36.7 bits (81), Expect = 0.59
 Identities = 27/96 (28%), Positives = 41/96 (42%), Gaps = 11/96 (11%)
 Frame = -3

Query: 642 TDSATMYWTAKLSCLPAS--------AKASLPNISAPPL*NFCAYAGSEFSTKMPEIYSN 487
           +D  T Y + ++ CLPA          K + P    PPL + C Y    +S +  E +S 
Sbjct: 5   SDRGTAYVSCRIHCLPACFSRAVVAVCKLTSPAPGIPPLVSLCRYGLPGYSAQEGEAFSA 64

Query: 486 RSAGTRPRCLVPTLF---ATESGGVSWSPPIQTALP 388
            ++G  PR  +P +    A      S SP  + A P
Sbjct: 65  AASGLHPRHQLPFVLSRVAASKAIASLSPDKRAACP 100


>UniRef50_A6S277 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 1215

 Score = 36.7 bits (81), Expect = 0.59
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +1

Query: 34  NTPPPPLRYPSNPATAIFTNAQT-YNNAPGYVPPTTRDNKMDTSRSNSTNSVA 189
           N PPP L  P+ P T+ FT   T   +AP   PP  R    + SR+ ST S+A
Sbjct: 625 NPPPPTLHLPT-PPTSEFTQLPTPQTHAPAVPPPQPRPASGNFSRTASTGSMA 676


>UniRef50_UPI00015B6434 Cluster: PREDICTED: similar to daughterless;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           daughterless - Nasonia vitripennis
          Length = 652

 Score = 36.3 bits (80), Expect = 0.77
 Identities = 21/74 (28%), Positives = 32/74 (43%)
 Frame = +1

Query: 19  GNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAP 198
           G  Y +T PP L + ++P  A+ T +Q   + PG  P    D  +   R   TN+  I  
Sbjct: 381 GAIYSHTSPPQLDHLTSPHPAV-TVSQPQGSYPGLAPTPDTDGTIKVERQPVTNAKYITV 439

Query: 199 YNKSKEPTLDAGES 240
             +   P    GE+
Sbjct: 440 EKRKDPPDSSGGET 453


>UniRef50_A0TBY9 Cluster: Putative uncharacterized protein; n=2;
           Burkholderia cepacia complex|Rep: Putative
           uncharacterized protein - Burkholderia ambifaria MC40-6
          Length = 564

 Score = 36.3 bits (80), Expect = 0.77
 Identities = 20/59 (33%), Positives = 31/59 (52%)
 Frame = +3

Query: 72  GNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLV 248
           G   +  R +  QR + RAA  AR+Q GH+ +  H   +DR ++ +Q    R R +Y V
Sbjct: 336 GRQQVADREDRHQRDQRRAARPAREQQGHQRRADHH--ADR-IRADQHAGLRNRHVYAV 391


>UniRef50_UPI0000DB70E7 Cluster: PREDICTED: similar to LSY-2-Like
           family member (lsl-1); n=1; Apis mellifera|Rep:
           PREDICTED: similar to LSY-2-Like family member (lsl-1) -
           Apis mellifera
          Length = 154

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 17/55 (30%), Positives = 30/55 (54%)
 Frame = +3

Query: 72  GNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRR 236
           GN H+H R  L Q  + +  +  +QQ  H+ QQQ +    ++ QQEQ    ++++
Sbjct: 25  GNHHVH-RHELHQEQQQQQQHQQQQQQQHQQQQQQQYHHQQSQQQEQHFQQQQQQ 78


>UniRef50_Q06I87 Cluster: Fasciclin-like protein FLA19; n=1;
           Triticum aestivum|Rep: Fasciclin-like protein FLA19 -
           Triticum aestivum (Wheat)
          Length = 480

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +3

Query: 78  GHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARR 230
           GH+H+R +L    R RAA   RQ+ GH   +  + G+ R   QE++  AR+
Sbjct: 408 GHLHRRQDLGAGHRRRAAAGGRQEAGHAGVRPGQEGARRHRLQEEQAPARQ 458


>UniRef50_Q92793 Cluster: CREB-binding protein; n=64;
            Euteleostomi|Rep: CREB-binding protein - Homo sapiens
            (Human)
          Length = 2442

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 19/68 (27%), Positives = 32/68 (47%)
 Frame = +1

Query: 37   TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
            TPP P   P+ P+T + ++ QT    PG VP  T+     T ++ +   V   P    + 
Sbjct: 878  TPPQPAA-PTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQP 936

Query: 217  PTLDAGES 240
            P++   +S
Sbjct: 937  PSVATPQS 944


>UniRef50_A7F2U2 Cluster: Predicted protein; n=1; Sclerotinia
           sclerotiorum 1980|Rep: Predicted protein - Sclerotinia
           sclerotiorum 1980
          Length = 662

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 2/63 (3%)
 Frame = +1

Query: 40  PPPPLRYPSNPATAIFTNAQTYNNAPGYVPP--TTRDNKMDTSRSNSTNSVAIAPYNKSK 213
           PPPPL  P  P+T       TY N P   PP      +K  +    STN+  +A  N + 
Sbjct: 65  PPPPLTEPEPPSTV------TYGNHPHPHPPPKPLEQSKRQSVYEKSTNACLLAHINSNL 118

Query: 214 EPT 222
           EP+
Sbjct: 119 EPS 121


>UniRef50_A7EDH7 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 486

 Score = 35.1 bits (77), Expect = 1.8
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 2/66 (3%)
 Frame = +1

Query: 31  YNTPPPPLRY--PSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYN 204
           YN+ P P     PS+PA   F  +  ++N+P   P +   +  +T+ ++S +S    PY 
Sbjct: 335 YNSSPSPTDTCNPSHPARNSFPRSDIFSNSPSSTPGSFPTSSSETTSTSSESSAYPFPYI 394

Query: 205 KSKEPT 222
               PT
Sbjct: 395 AMSGPT 400


>UniRef50_UPI0000DB7668 Cluster: PREDICTED: similar to CG14073-PA,
           isoform A; n=1; Apis mellifera|Rep: PREDICTED: similar
           to CG14073-PA, isoform A - Apis mellifera
          Length = 2590

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 21/54 (38%), Positives = 29/54 (53%)
 Frame = +1

Query: 40  PPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPY 201
           PPPPL  PS  A++   N Q  N   G V P++ DN    + S+S  S ++ PY
Sbjct: 69  PPPPLSLPSQSASSGNANDQETNRYLGDVRPSSVDN---AATSSSFWSPSVEPY 119


>UniRef50_Q4QDP4 Cluster: Putative uncharacterized protein; n=3;
            Leishmania|Rep: Putative uncharacterized protein -
            Leishmania major
          Length = 1964

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 69   SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRT 218
            SG  H+  + N  +RA  +A Y+ARQQ    P+QQ    + +   + + T
Sbjct: 1277 SGVKHLLDQVNRSRRAERQARYEARQQPAQRPEQQTDTNAAQNASEHRST 1326


>UniRef50_Q07283 Cluster: Trichohyalin; n=9; Eukaryota|Rep:
           Trichohyalin - Homo sapiens (Human)
          Length = 1898

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = +3

Query: 48  AAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDAR 227
           A E  L S  GH  +    +++ R R   + R++   E QQQ +   DR  Q+E+  + R
Sbjct: 188 AEEEQLQSCKGHETEEFPDEEQLRRRELLELRRKGREEKQQQRRERQDRVFQEEEEKEWR 247

Query: 228 RRRIYL 245
           +R   L
Sbjct: 248 KRETVL 253


>UniRef50_Q9YMJ3 Cluster: LdOrf-134 peptide; n=1; Lymantria dispar
           MNPV|Rep: LdOrf-134 peptide - Lymantria dispar
           multicapsid nuclear polyhedrosis virus (LdMNPV)
          Length = 122

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQ-NGHEPQQQHKLGSDRTVQQEQRTDARRRRIY 242
           H RA +  RAR     DAR+    H   ++H  G D     +QR DAR  +I+
Sbjct: 14  HHRAGVSVRARGGFGVDARRAVRAHGTLEEHSHGPDEQAGVQQRRDARHVQIF 66


>UniRef50_Q54YJ4 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 702

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           HQ+   QQ  + +     +QQ  H+PQQQH+    +  QQ Q+   ++++    QQ
Sbjct: 520 HQQQQHQQPLQQQIQQQQQQQQQHQPQQQHQPQQQQQQQQPQQQQQQQQQQQQQQQ 575


>UniRef50_Q9RZD6 Cluster: Ferredoxin-nitrite reductase; n=2;
           Deinococcus|Rep: Ferredoxin-nitrite reductase -
           Deinococcus radiodurans
          Length = 563

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 6/62 (9%)
 Frame = +2

Query: 440 AKRVGTRQRGRVPAERF-EYISGI---FVLNSLP--AYAQKFYNGGADMLGKDALAEAGK 601
           A+R GT+ RG VPAER  EY   +   F  N  P  ++ +     GAD    D + + GK
Sbjct: 499 AQRTGTKLRGIVPAERLTEYTDRVISDFKANKTPGESFVEYADRVGADRFVPDTVLDGGK 558

Query: 602 QL 607
           +L
Sbjct: 559 EL 560


>UniRef50_A0DR04 Cluster: Chromosome undetermined scaffold_6, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_6,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 851

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 17/66 (25%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +3

Query: 81  HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRI-YLVQQC 257
           +++Q  N QQ+ +++  Y  +QQ   + QQQ +    +  QQ+Q+   +++ I ++ Q  
Sbjct: 440 NMYQNQNTQQQQQLQQQYQQQQQQQQQQQQQQQYQQQQQQQQQQQQQQQQQFITHIPQNQ 499

Query: 258 VDFVQK 275
             F Q+
Sbjct: 500 TQFQQQ 505


>UniRef50_A6RA09 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 494

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 20/59 (33%), Positives = 24/59 (40%)
 Frame = +1

Query: 22  NFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAP 198
           N  Y TPPPP   P NP T+  T+  T    P   P    +    TS +    S A  P
Sbjct: 315 NNRYQTPPPPTTQPINPFTSTSTSDTTIQTPPSTSPGVLAN--QHTSNNAPQPSAAAGP 371


>UniRef50_UPI00015B5277 Cluster: PREDICTED: similar to
           ENSANGP00000026266; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000026266 - Nasonia
           vitripennis
          Length = 1397

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 3/56 (5%)
 Frame = +3

Query: 81  HIHQRANLQQRARVRAAYDARQQNGHE---PQQQHKLGSDRTVQQEQRTDARRRRI 239
           H HQ+   QQ+A+ +      QQ+  +   PQQQH+L      QQ+Q+   +++ +
Sbjct: 286 HAHQQQAQQQQAQQQQQQQQHQQHPQQQQQPQQQHQLPQQPQQQQQQQPQQQQQHV 341


>UniRef50_Q9CFD3 Cluster: Putative uncharacterized protein ypiL;
           n=5; Lactococcus lactis|Rep: Putative uncharacterized
           protein ypiL - Lactococcus lactis subsp. lactis
           (Streptococcus lactis)
          Length = 810

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 19/43 (44%), Positives = 22/43 (51%), Gaps = 2/43 (4%)
 Frame = +1

Query: 10  DERGNFYYNTPPPPLRY-PSNP-ATAIFTNAQTYNNAPGYVPP 132
           DE  N YY   PP + Y  SNP AT  + N   Y   P Y+PP
Sbjct: 582 DETLNVYYKYVPPIIYYNTSNPYATTYYANGYEY--VPNYIPP 622


>UniRef50_Q8F0H1 Cluster: Putative uncharacterized protein; n=4;
           Leptospira|Rep: Putative uncharacterized protein -
           Leptospira interrogans
          Length = 229

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 14/52 (26%), Positives = 31/52 (59%)
 Frame = +2

Query: 482 ERFEYISGIFVLNSLPAYAQKFYNGGADMLGKDALAEAGKQLSLAVQYMVAE 637
           ++  +++ +F+L ++PA+AQ    G AD+   D  +E G   + ++Q +V +
Sbjct: 21  KKITWLTILFILLNVPAFAQNKEKGQADLSRSDVFSEQGSSYTKSLQKIVRD 72


>UniRef50_Q8WS39 Cluster: Similar to adenomatous polyposis; n=1;
            Oikopleura dioica|Rep: Similar to adenomatous polyposis -
            Oikopleura dioica (Tunicate)
          Length = 1380

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 5/55 (9%)
 Frame = +1

Query: 91   NAQTYNNA-----PGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTLDAGES 240
            N+++ NNA     P Y  P  + + M T+ + ST S+ I   +KSK+P+  A ES
Sbjct: 1087 NSESRNNAISAIDPPYFDPPVQRSPMKTATALSTGSLPIVSPSKSKKPSKAASES 1141


>UniRef50_Q54MY9 Cluster: Protein serine/threonine kinase; n=2;
           Dictyostelium discoideum|Rep: Protein serine/threonine
           kinase - Dictyostelium discoideum AX4
          Length = 860

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 1/89 (1%)
 Frame = +1

Query: 22  NFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPP-TTRDNKMDTSRSNSTNSVAIAP 198
           ++YYN         S   T IF+N  ++ N     PP TT      T+ S+S NS  I  
Sbjct: 239 SYYYNN------MSSKRKTTIFSNNISFTNLQTTTPPTTTTTTTTTTTTSSSNNSEQIES 292

Query: 199 YNKSKEPTLDAGESIWYNNVWILFKKLLD 285
            +K+    + +  SI   N   L KKL +
Sbjct: 293 TSKNNSSGITSPTSIKPKNKVGLLKKLFN 321


>UniRef50_Q54MR8 Cluster: RING Zn finger-containing protein; n=1;
           Dictyostelium discoideum AX4|Rep: RING Zn
           finger-containing protein - Dictyostelium discoideum AX4
          Length = 1088

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 29/139 (20%), Positives = 63/139 (45%), Gaps = 1/139 (0%)
 Frame = +3

Query: 99  NLQQRARVRAAYDARQQNGH-EPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCVDFVQK 275
           NLQQ  + +     +QQ    + QQQ +    +  QQ+Q+   +++++  +QQ     Q+
Sbjct: 203 NLQQPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQQLQQQPPLQQQ 262

Query: 276 IIRYYRCNDMSELSPLMIHFINTIRDMCIDTNPINVNVVKRFESEETMIRHLIRLQKELG 455
            I     N+ +  +   ++    +     D  PI +    R + ++   +HL +++ +  
Sbjct: 263 NIIQQADNNNNTTNEENVYNNQDLGFQITDDMPIRLRQRLR-QHQQQQQKHLDQIRLQEL 321

Query: 456 QGNAAESLPSDSNIFQASL 512
           Q   AE++  D  + QA +
Sbjct: 322 QEQLAETISRDDQVGQAMI 340


>UniRef50_A7S830 Cluster: Predicted protein; n=16; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 912

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +1

Query: 88  TNAQTYNNAPGYVPPTT-RDNKMDTSRSNSTNSVAIAPYNKSKEPTLDAGES 240
           T+A T    P   PPTT ++   D S S S  + A  P   +KEPT DA  S
Sbjct: 646 TSAATTTAPPTTAPPTTTKEPTTDASTSTSAATTAALP-TTTKEPTTDASTS 696


>UniRef50_Q2HGB0 Cluster: Putative uncharacterized protein; n=2;
           Eukaryota|Rep: Putative uncharacterized protein -
           Chaetomium globosum (Soil fungus)
          Length = 1378

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%)
 Frame = +1

Query: 19  GNFYYNTPPPPLRYPSNPATAI-FTNAQTYNNAPGYVPPTT 138
           G++    PPPP  Y   PA A  F  A +Y   P Y  P+T
Sbjct: 670 GHYPQLQPPPPQPYQPQPAAAAPFVLATSYEQQPSYAAPST 710


>UniRef50_A6RQS8 Cluster: Predicted protein; n=1; Botryotinia
           fuckeliana B05.10|Rep: Predicted protein - Botryotinia
           fuckeliana B05.10
          Length = 190

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 11/91 (12%)
 Frame = +1

Query: 1   SMTDERGNFYYNTPPPPLRYPSNP-ATAIFTNAQ-TYNNAPGYVPP-------TTRDNK- 150
           S T ++       PPPPL  P NP A++   N + T    PG  P        T R N  
Sbjct: 24  SQTQQQQQQQQPPPPPPLLPPRNPLASSPDDNEESTIRGVPGDDPSAIPLPLFTRRSNSN 83

Query: 151 -MDTSRSNSTNSVAIAPYNKSKEPTLDAGES 240
            +  + +NST++    P N+   PT+++ E+
Sbjct: 84  LLSQTSANSTHNTTPTPSNRPPAPTVESYET 114


>UniRef50_Q9V8R9 Cluster: Protein 4.1 homolog; n=6; Sophophora|Rep:
           Protein 4.1 homolog - Drosophila melanogaster (Fruit
           fly)
          Length = 1698

 Score = 33.5 bits (73), Expect = 5.5
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = +1

Query: 1   SMTDERGNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRD 144
           S +  +G   Y++  P    P +  TA F  +Q YN  PGYV P+  D
Sbjct: 685 SYSPTKGPQGYSSGAPGSYKPISDPTADFLESQRYNKEPGYVGPSKAD 732


>UniRef50_Q7R506 Cluster: GLP_137_65224_61523; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_137_65224_61523 - Giardia lamblia
           ATCC 50803
          Length = 1233

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 14/42 (33%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +3

Query: 216 TDARRRRIYLV-QQCVDFVQKIIRYYRCNDMSELSPLMIHFI 338
           +DARR   YLV ++CV  ++ +++YYR ++     PL++  +
Sbjct: 78  SDARRHSYYLVMEECVGNLENLVQYYRLHEEIIPEPLILEIL 119


>UniRef50_Q54WE6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 374

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 1/65 (1%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQ-EQRTDARRRRIYLVQQCVD 263
           H + NLQQ+ + +     +QQ   + QQQ K    +  QQ +Q+   ++++  L+QQ   
Sbjct: 3   HNKQNLQQKQQQQQQQQKQQQQKQQQQQQQKQQQQQQQQQKQQQQQYQQQQQQLLQQQQQ 62

Query: 264 FVQKI 278
            +Q +
Sbjct: 63  LLQSL 67


>UniRef50_Q54M27 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1003

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 22/68 (32%), Positives = 35/68 (51%)
 Frame = +3

Query: 72  GNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQ 251
           G  H HQ+   QQ+ + +  Y  +QQN H+ QQQ         +Q+Q  D ++++ Y  Q
Sbjct: 403 GEQHQHQQ---QQQQQQQQNYGEQQQNYHQQQQQQNFS-----EQQQNDDQQQQQHYSEQ 454

Query: 252 QCVDFVQK 275
           Q  D  Q+
Sbjct: 455 QQNDDQQQ 462


>UniRef50_Q5KNU5 Cluster: IDN3-B, putative; n=2; Filobasidiella
           neoformans|Rep: IDN3-B, putative - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 1924

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 7/64 (10%)
 Frame = +1

Query: 28  YYNTPPPPLR-YPSNP--ATAIFTN--AQTYNNAPGYVPPTTRDNKMDTS--RSNSTNSV 186
           YY+ PP P+  + S P  A A ++N  + +YN  P Y+PP+T            NST++ 
Sbjct: 89  YYSGPPTPVSDHQSQPHIAPASYSNTPSMSYNFLPAYMPPSTPTTSTHNGCCVGNSTSTS 148

Query: 187 AIAP 198
            + P
Sbjct: 149 PVTP 152


>UniRef50_A7TI39 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 861

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 15/55 (27%), Positives = 29/55 (52%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           Q+    Q+ + +  Y  +QQ  H+ Q QH+    +  QQ+Q+   +++R +  QQ
Sbjct: 42  QQQQQHQQQQQQYQYQQQQQQQHQQQHQHQHQQQQQQQQQQQQQQQQQRQFQYQQ 96


>UniRef50_A5E1X0 Cluster: Predicted protein; n=1; Lodderomyces
           elongisporus NRRL YB-4239|Rep: Predicted protein -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 333

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 22/100 (22%), Positives = 47/100 (47%), Gaps = 1/100 (1%)
 Frame = +3

Query: 123 RAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCVDFVQKIIRYYRCND 302
           + +   +QQ   + QQQH+   ++   Q+Q+   ++R  +    CV   +K+ R      
Sbjct: 146 KCSQQQQQQQQQQQQQQHQNQQEQQFTQQQQQQQQQRNHHQEPHCVQLYRKLTRQLDAAF 205

Query: 303 MSELSPLMIHFINTIR-DMCIDTNPINVNVVKRFESEETM 419
           ++ L P       TI+ D+ + +  I+ N+   F+S  ++
Sbjct: 206 LNSLYPADAASKFTIKQDVLLPS--ISANLKLEFDSSSSL 243


>UniRef50_A4RD94 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 809

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 21/74 (28%), Positives = 38/74 (51%)
 Frame = +3

Query: 33  QHPSAAAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQ 212
           QHP+ AA  ++     H   +A+ Q +A+ +A   A+QQ   + QQQ +    +  QQ+Q
Sbjct: 212 QHPNPAAIAAM--QQAHAQAQAHAQAQAQ-QAQQQAQQQQAQQQQQQQQQQQQQQQQQQQ 268

Query: 213 RTDARRRRIYLVQQ 254
           +    +++    QQ
Sbjct: 269 QQQQAQQQQQQQQQ 282


>UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein;
           n=39; Eukaryota|Rep: Neural Wiskott-Aldrich syndrome
           protein - Homo sapiens (Human)
          Length = 505

 Score = 33.1 bits (72), Expect = 7.2
 Identities = 14/26 (53%), Positives = 16/26 (61%)
 Frame = -1

Query: 647 TSPIPPPCTGRPS*VVCPPRPKRLYP 570
           T+  PPP   RPS  V PP P R+YP
Sbjct: 319 TAAPPPPPPSRPSVAVPPPPPNRMYP 344


>UniRef50_UPI00015B4A0A Cluster: PREDICTED: similar to CG11290-PA;
            n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
            CG11290-PA - Nasonia vitripennis
          Length = 2811

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 15/51 (29%), Positives = 29/51 (56%)
 Frame = +3

Query: 81   HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRR 233
            H H +   QQ+A+ +A   A+QQ   + QQQ +  + +  QQ+ +  A+++
Sbjct: 2360 HAHNQQQAQQQAQQQAHQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQAQQQ 2410


>UniRef50_Q54P98 Cluster: Ras interacting protein; n=2;
           Dictyostelium discoideum|Rep: Ras interacting protein -
           Dictyostelium discoideum AX4
          Length = 838

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 3/79 (3%)
 Frame = +3

Query: 27  LLQHPSAAAEVSL*SGNGHIHQRA---NLQQRARVRAAYDARQQNGHEPQQQHKLGSDRT 197
           LL  P + +  +  SGN      A   N QQ+ + +A    +QQ   + QQQH+    + 
Sbjct: 61  LLYRPVSTSNNNATSGNSTPPNNAISPNQQQQQQQQAQQQQQQQQQQQQQQQHQQQQQQQ 120

Query: 198 VQQEQRTDARRRRIYLVQQ 254
            QQ+Q+   ++++    QQ
Sbjct: 121 QQQQQQQQQQQQQQQAQQQ 139


>UniRef50_A7RZW0 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 300

 Score = 32.7 bits (71), Expect = 9.5
 Identities = 16/35 (45%), Positives = 20/35 (57%)
 Frame = +1

Query: 61  PSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSR 165
           P    TAI  NA T  +     PP T+DN+M+TSR
Sbjct: 227 PGPVRTAIRDNAFTEQDKGVVAPPATKDNRMETSR 261


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 730,127,489
Number of Sequences: 1657284
Number of extensions: 15697783
Number of successful extensions: 73839
Number of sequences better than 10.0: 48
Number of HSP's better than 10.0 without gapping: 57662
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 68317
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 59265488880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -