SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120016.Seq
         (678 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4SV63 Cluster: Chromosome undetermined SCAF13786, whol...    95   1e-18
UniRef50_Q4EB85 Cluster: Gag-pol polyprotein; n=1; Wolbachia end...    95   1e-18
UniRef50_UPI00015B4A3C Cluster: PREDICTED: similar to pol polypr...    91   3e-17
UniRef50_UPI00015B43DC Cluster: PREDICTED: similar to gag-pol po...    90   5e-17
UniRef50_UPI00015B44BD Cluster: PREDICTED: similar to gag-pol po...    89   7e-17
UniRef50_UPI00015B4898 Cluster: PREDICTED: similar to gag-pol po...    88   2e-16
UniRef50_UPI00015B47EB Cluster: PREDICTED: similar to pol polypr...    87   3e-16
UniRef50_Q9BM80 Cluster: Gag-pol polyprotein; n=15; Bilateria|Re...    87   4e-16
UniRef50_UPI00015B479F Cluster: PREDICTED: similar to gag-pol po...    85   1e-15
UniRef50_UPI00015B4618 Cluster: PREDICTED: similar to Gag and Po...    85   2e-15
UniRef50_UPI00015B47F6 Cluster: PREDICTED: similar to pol polypr...    84   3e-15
UniRef50_UPI00015B5919 Cluster: PREDICTED: similar to pol polypr...    83   8e-15
UniRef50_Q6IFT8 Cluster: Pol polyprotein; n=1; Schistosoma manso...    82   1e-14
UniRef50_A0ND95 Cluster: ENSANGP00000030414; n=6; Bilateria|Rep:...    82   1e-14
UniRef50_UPI00015B4478 Cluster: PREDICTED: similar to pol polypr...    81   2e-14
UniRef50_UPI0000E4A4EC Cluster: PREDICTED: similar to gag-pol po...    81   2e-14
UniRef50_UPI00015B5276 Cluster: PREDICTED: hypothetical protein;...    81   2e-14
UniRef50_UPI00015B4703 Cluster: PREDICTED: similar to gag-pol po...    81   3e-14
UniRef50_UPI0000F1F2AF Cluster: PREDICTED: similar to pol polypr...    81   3e-14
UniRef50_UPI00015B47AA Cluster: PREDICTED: similar to pol polypr...    80   4e-14
UniRef50_UPI00015B45E6 Cluster: PREDICTED: similar to gag-pol po...    80   4e-14
UniRef50_UPI00015B4374 Cluster: PREDICTED: similar to gag-pol po...    80   6e-14
UniRef50_UPI00015B43B7 Cluster: PREDICTED: similar to gag-pol po...    79   1e-13
UniRef50_UPI0000E47AD9 Cluster: PREDICTED: similar to gag-pol po...    79   1e-13
UniRef50_UPI0000F1FB27 Cluster: PREDICTED: similar to novel tran...    79   1e-13
UniRef50_UPI0000F1F6B2 Cluster: PREDICTED: similar to pol polypr...    77   5e-13
UniRef50_UPI0000F1F14F Cluster: PREDICTED: similar to pol polypr...    77   5e-13
UniRef50_Q5JPZ2 Cluster: OSJNBa0004L19.22 protein; n=8; Oryza sa...    76   9e-13
UniRef50_UPI00015B47E9 Cluster: PREDICTED: hypothetical protein;...    75   2e-12
UniRef50_UPI00015B5709 Cluster: PREDICTED: similar to pol polypr...    74   4e-12
UniRef50_UPI0000F1F7D8 Cluster: PREDICTED: similar to pol polypr...    74   4e-12
UniRef50_Q3C0I2 Cluster: Putative uncharacterized protein; n=5; ...    74   4e-12
UniRef50_A5AVS3 Cluster: Putative uncharacterized protein; n=8; ...    74   4e-12
UniRef50_Q99315 Cluster: Transposon Ty3-G Gag-Pol polyprotein (G...    74   4e-12
UniRef50_UPI00015B4A3B Cluster: PREDICTED: similar to orf; n=1; ...    73   5e-12
UniRef50_UPI00015B47F9 Cluster: PREDICTED: hypothetical protein;...    73   5e-12
UniRef50_UPI0000F1D578 Cluster: PREDICTED: similar to sarcoma an...    73   9e-12
UniRef50_Q01M69 Cluster: OSIGBa0114M03.4 protein; n=10; Oryza sa...    73   9e-12
UniRef50_A5BU14 Cluster: Putative uncharacterized protein; n=5; ...    73   9e-12
UniRef50_Q8TFI2 Cluster: Pol protein; n=2; Kazachstania exigua|R...    73   9e-12
UniRef50_UPI0000F1FB24 Cluster: PREDICTED: similar to novel tran...    72   1e-11
UniRef50_Q967S6 Cluster: Reverse transcriptase-like polymerase; ...    72   1e-11
UniRef50_Q84ZV5 Cluster: Polyprotein; n=2; Papilionoideae|Rep: P...    71   2e-11
UniRef50_Q2R2N6 Cluster: Retrotransposon protein, putative, uncl...    71   2e-11
UniRef50_Q2R1M0 Cluster: Retrotransposon protein, putative, uncl...    71   2e-11
UniRef50_Q0DB93 Cluster: Os06g0590100 protein; n=11; Oryza sativ...    71   2e-11
UniRef50_A5B9Z6 Cluster: Putative uncharacterized protein; n=1; ...    71   2e-11
UniRef50_Q5KTM2 Cluster: Reverse transcriptase; n=1; Bombyx mori...    71   3e-11
UniRef50_UPI00015B4A7F Cluster: PREDICTED: hypothetical protein;...    71   3e-11
UniRef50_Q0DC29 Cluster: Os06g0493000 protein; n=8; Eukaryota|Re...    71   3e-11
UniRef50_A5BVZ5 Cluster: Putative uncharacterized protein; n=3; ...    71   3e-11
UniRef50_Q9LHM4 Cluster: Retroelement pol polyprotein; n=2; Arab...    70   5e-11
UniRef50_A2Q2C7 Cluster: RNA-directed DNA polymerase (Reverse tr...    70   5e-11
UniRef50_UPI00015B4945 Cluster: PREDICTED: hypothetical protein;...    69   8e-11
UniRef50_UPI0000F1DEA3 Cluster: PREDICTED: hypothetical protein;...    69   8e-11
UniRef50_Q7XGR4 Cluster: Retrotransposon protein, putative, uncl...    69   8e-11
UniRef50_Q5MG92 Cluster: Putative retrotransposon polyprotein; n...    69   8e-11
UniRef50_Q53NJ3 Cluster: Retrotransposon protein, putative, uncl...    69   8e-11
UniRef50_Q2QUR6 Cluster: Retrotransposon protein, putative, Ty3-...    69   8e-11
UniRef50_Q0DZB8 Cluster: Os02g0633000 protein; n=3; Oryza sativa...    69   8e-11
UniRef50_UPI00015B4B9B Cluster: PREDICTED: hypothetical protein,...    69   1e-10
UniRef50_UPI00015B47C1 Cluster: PREDICTED: similar to gag-pol po...    69   1e-10
UniRef50_UPI0000E49FEF Cluster: PREDICTED: similar to LReO_3; n=...    69   1e-10
UniRef50_UPI0000E46771 Cluster: PREDICTED: similar to retrotrans...    69   1e-10
UniRef50_Q7XW39 Cluster: OSJNBb0062H02.17 protein; n=5; Oryza sa...    69   1e-10
UniRef50_UPI0000F1F902 Cluster: PREDICTED: similar to pol polypr...    69   1e-10
UniRef50_Q7XPW2 Cluster: OSJNBa0032F06.19 protein; n=4; Eukaryot...    69   1e-10
UniRef50_Q259G0 Cluster: H0124B04.16 protein; n=1; Oryza sativa|...    69   1e-10
UniRef50_Q6B961 Cluster: Polyprotein; n=4; Candida glabrata|Rep:...    69   1e-10
UniRef50_P92523 Cluster: Uncharacterized mitochondrial protein A...    69   1e-10
UniRef50_UPI00015B487E Cluster: PREDICTED: similar to protease, ...    68   2e-10
UniRef50_UPI0000F21643 Cluster: PREDICTED: similar to pol polypr...    68   2e-10
UniRef50_Q9SQW9 Cluster: Putative retroelement pol polyprotein; ...    68   2e-10
UniRef50_Q7XPJ7 Cluster: OSJNBa0087O24.13 protein; n=5; Oryza sa...    68   2e-10
UniRef50_Q5NRP7 Cluster: Putative gag-pol polyprotein, identical...    68   2e-10
UniRef50_A5AR78 Cluster: Putative uncharacterized protein; n=1; ...    68   2e-10
UniRef50_Q4QQF4 Cluster: Gag-pol polyprotein; n=8; Bilateria|Rep...    68   2e-10
UniRef50_P10394 Cluster: Retrovirus-related Pol polyprotein from...    68   2e-10
UniRef50_UPI00015B484B Cluster: PREDICTED: similar to protease, ...    68   2e-10
UniRef50_UPI00015B43B8 Cluster: PREDICTED: similar to protease, ...    68   2e-10
UniRef50_UPI0000F211A4 Cluster: PREDICTED: similar to LReO_3; n=...    68   2e-10
UniRef50_UPI0000F1ED4F Cluster: PREDICTED: similar to pol polypr...    68   2e-10
UniRef50_Q75J00 Cluster: Retrotransposon protein, putative, Ty3-...    68   2e-10
UniRef50_UPI00015B487C Cluster: PREDICTED: similar to protease, ...    67   3e-10
UniRef50_UPI00015B4584 Cluster: PREDICTED: similar to retrotrans...    67   3e-10
UniRef50_UPI00015B455D Cluster: PREDICTED: similar to polyprotei...    67   3e-10
UniRef50_UPI00015B455C Cluster: PREDICTED: hypothetical protein;...    67   3e-10
UniRef50_UPI00015B44F9 Cluster: PREDICTED: similar to conserved ...    67   3e-10
UniRef50_UPI0000F1DF9A Cluster: PREDICTED: similar to pol polypr...    67   3e-10
UniRef50_UPI0000D71B54 Cluster: PREDICTED: similar to transposas...    67   3e-10
UniRef50_Q9LQH2 Cluster: F15O4.13; n=7; Eukaryota|Rep: F15O4.13 ...    67   3e-10
UniRef50_A2I5E5 Cluster: Retrotransposon protein; n=1; Beta vulg...    67   3e-10
UniRef50_Q6GV81 Cluster: Pol protein; n=1; Oikopleura dioica|Rep...    67   3e-10
UniRef50_O46115 Cluster: Protease; n=6; Eukaryota|Rep: Protease ...    67   3e-10
UniRef50_Q15F61 Cluster: Pol polyprotein; n=1; Nosema bombycis|R...    67   3e-10
UniRef50_A7TGN7 Cluster: Tkp3 protein; n=1; Vanderwaltozyma poly...    67   3e-10
UniRef50_UPI00015B459B Cluster: PREDICTED: similar to protease, ...    67   4e-10
UniRef50_UPI00015B452C Cluster: PREDICTED: hypothetical protein,...    67   4e-10
UniRef50_UPI0000F1FE5B Cluster: PREDICTED: hypothetical protein;...    67   4e-10
UniRef50_Q94LP8 Cluster: Putative polyprotein; n=1; Oryza sativa...    67   4e-10
UniRef50_Q6MWI9 Cluster: B1159F04.11 protein; n=7; Oryza sativa|...    67   4e-10
UniRef50_A7BIS0 Cluster: Pro-pol protein; n=1; Lentinula edodes|...    67   4e-10
UniRef50_UPI00015B440F Cluster: PREDICTED: similar to protease, ...    66   6e-10
UniRef50_UPI0000F1FA6A Cluster: PREDICTED: similar to pol polypr...    66   6e-10
UniRef50_A5B7A2 Cluster: Putative uncharacterized protein; n=1; ...    66   6e-10
UniRef50_A5B704 Cluster: Putative uncharacterized protein; n=1; ...    66   6e-10
UniRef50_Q8ITE3 Cluster: Reverse transcriptase/RNaseH; n=1; Sole...    66   6e-10
UniRef50_UPI0000F1E415 Cluster: PREDICTED: similar to pol polypr...    66   7e-10
UniRef50_UPI00005480D8 Cluster: PREDICTED: similar to LReO_3; n=...    66   7e-10
UniRef50_Q94BM2 Cluster: Gag-pol polyprotein; n=29; Magnoliophyt...    66   1e-09
UniRef50_Q7XQM2 Cluster: OSJNBa0089E12.2 protein; n=79; Eukaryot...    66   1e-09
UniRef50_Q2QSA6 Cluster: Retrotransposon protein, putative, uncl...    66   1e-09
UniRef50_A5AZ23 Cluster: Putative uncharacterized protein; n=2; ...    66   1e-09
UniRef50_A5ATZ0 Cluster: Putative uncharacterized protein; n=1; ...    66   1e-09
UniRef50_UPI0000F1FF62 Cluster: signal transduction and activati...    65   1e-09
UniRef50_UPI0000F1F28A Cluster: PREDICTED: similar to LReO_3; n=...    65   1e-09
UniRef50_UPI0000E471ED Cluster: PREDICTED: similar to zinc finge...    65   1e-09
UniRef50_UPI0000E471C8 Cluster: PREDICTED: similar to zinc finge...    65   1e-09
UniRef50_Q9AYB6 Cluster: Polyprotein; n=47; Magnoliophyta|Rep: P...    65   1e-09
UniRef50_Q84UZ3 Cluster: Reverse-transcriptase; n=2; Chlamydomon...    65   1e-09
UniRef50_Q53M59 Cluster: Retrotransposon protein, putative, Ty3-...    65   1e-09
UniRef50_Q53L74 Cluster: Retrotransposon protein, putative, Ty3-...    65   1e-09
UniRef50_Q53J66 Cluster: Retrotransposon protein, putative, Ty3-...    65   1e-09
UniRef50_Q33A89 Cluster: Retrotransposon protein, putative, uncl...    65   1e-09
UniRef50_Q2R2D1 Cluster: Retrotransposon protein, putative, Ty3-...    65   1e-09
UniRef50_Q01KW5 Cluster: H0211A12.9 protein; n=2; Oryza sativa|R...    65   1e-09
UniRef50_Q5ABJ9 Cluster: Possible Tca8 reverse transcriptase; n=...    65   1e-09
UniRef50_A4QRY3 Cluster: Putative uncharacterized protein; n=35;...    65   1e-09
UniRef50_Q8I7P9 Cluster: Retrovirus-related Pol polyprotein from...    65   1e-09
UniRef50_UPI00015B618C Cluster: PREDICTED: similar to protease, ...    65   2e-09
UniRef50_UPI00015B48A3 Cluster: PREDICTED: similar to reverse tr...    65   2e-09
UniRef50_UPI00015B43D9 Cluster: PREDICTED: similar to polypeptid...    65   2e-09
UniRef50_UPI0000F20443 Cluster: PREDICTED: similar to pol polypr...    65   2e-09
UniRef50_UPI0000E48D7B Cluster: PREDICTED: similar to ankyrin 2,...    65   2e-09
UniRef50_Q53J67 Cluster: Retrotransposon protein, putative, Ty3-...    65   2e-09
UniRef50_Q0DAQ7 Cluster: Os06g0638300 protein; n=6; Oryza sativa...    65   2e-09
UniRef50_A5AWI1 Cluster: Putative uncharacterized protein; n=1; ...    65   2e-09
UniRef50_A1YGR9 Cluster: Putative pol protein; n=1; Philodina ro...    65   2e-09
UniRef50_UPI00015B43C7 Cluster: PREDICTED: similar to gag-pol po...    64   2e-09
UniRef50_UPI0000F1E7B2 Cluster: PREDICTED: hypothetical protein;...    64   2e-09
UniRef50_UPI00005848C8 Cluster: PREDICTED: similar to OSJNBa0059...    64   2e-09
UniRef50_Q9SY43 Cluster: Putative reverse transcriptase; n=1; Ar...    64   2e-09
UniRef50_Q8L7J3 Cluster: Gag-pol polyprotein; n=30; Magnoliophyt...    64   2e-09
UniRef50_Q53P05 Cluster: Retrotransposon protein, putative, uncl...    64   2e-09
UniRef50_Q2R3G0 Cluster: Retrotransposon protein, putative, uncl...    64   2e-09
UniRef50_Q6H8S0 Cluster: Polyprotein; n=2; Yarrowia lipolytica|R...    64   2e-09
UniRef50_Q5QQL8 Cluster: Pol protein; n=1; Orpinomyces sp. OUS1|...    64   2e-09
UniRef50_Q15F62 Cluster: Pol polyprotein; n=1; Nosema bombycis|R...    64   2e-09
UniRef50_UPI00015B43E0 Cluster: PREDICTED: similar to protease, ...    64   3e-09
UniRef50_UPI0000E491A5 Cluster: PREDICTED: similar to transposas...    64   3e-09
UniRef50_Q6L4N0 Cluster: Putative uncharacterized protein P0530H...    64   3e-09
UniRef50_Q53JQ7 Cluster: Retrotransposon protein, putative, Ty3-...    64   3e-09
UniRef50_Q2QSH9 Cluster: Retrotransposon protein, putative, uncl...    64   3e-09
UniRef50_UPI00015B47AD Cluster: PREDICTED: similar to gag-pol po...    64   4e-09
UniRef50_UPI0000F1FACA Cluster: PREDICTED: similar to pol polypr...    64   4e-09
UniRef50_UPI0000F1E5A7 Cluster: PREDICTED: similar to pol polypr...    64   4e-09
UniRef50_UPI0000E49332 Cluster: PREDICTED: similar to OSJNBa0011...    64   4e-09
UniRef50_Q7XWZ0 Cluster: OSJNBb0072N21.12 protein; n=1; Oryza sa...    64   4e-09
UniRef50_Q2R264 Cluster: Retrotransposon protein, putative, uncl...    64   4e-09
UniRef50_Q2QPU3 Cluster: Retrotransposon protein, putative, uncl...    64   4e-09
UniRef50_O81490 Cluster: F9D12.11 protein; n=4; Arabidopsis thal...    64   4e-09
UniRef50_A5C623 Cluster: Putative uncharacterized protein; n=5; ...    64   4e-09
UniRef50_Q24310 Cluster: Polyprotein; n=1; Drosophila melanogast...    64   4e-09
UniRef50_Q9UVD8 Cluster: Pol; n=1; Alternaria alternata|Rep: Pol...    64   4e-09
UniRef50_UPI00015B4834 Cluster: PREDICTED: similar to gag-pol po...    63   5e-09
UniRef50_UPI00015B472B Cluster: PREDICTED: hypothetical protein;...    63   5e-09
UniRef50_A5X2S4 Cluster: Polyprotein; n=3; Spermatophyta|Rep: Po...    63   5e-09
UniRef50_A5C6S0 Cluster: Putative uncharacterized protein; n=1; ...    63   5e-09
UniRef50_A5C356 Cluster: Putative uncharacterized protein; n=1; ...    63   5e-09
UniRef50_Q05654 Cluster: Retrotransposable element Tf2 155 kDa p...    63   5e-09
UniRef50_UPI00015B48E9 Cluster: PREDICTED: similar to OSJNBa0042...    63   7e-09
UniRef50_UPI00015B4589 Cluster: PREDICTED: similar to protease, ...    63   7e-09
UniRef50_UPI00015B443A Cluster: PREDICTED: similar to protease, ...    63   7e-09
UniRef50_UPI00015B4386 Cluster: PREDICTED: hypothetical protein;...    63   7e-09
UniRef50_Q7XWU5 Cluster: OSJNBa0065B15.6 protein; n=1; Oryza sat...    63   7e-09
UniRef50_Q53K71 Cluster: Putative uncharacterized protein; n=1; ...    63   7e-09
UniRef50_Q339J2 Cluster: Retrotransposon protein, putative, Ty3-...    63   7e-09
UniRef50_Q2R8S5 Cluster: Retrotransposon protein, putative, Ty3-...    63   7e-09
UniRef50_Q2R634 Cluster: Retrotransposon protein, putative, Ty3-...    63   7e-09
UniRef50_A5C120 Cluster: Putative uncharacterized protein; n=1; ...    63   7e-09
UniRef50_Q94885 Cluster: Orf protein; n=1; Drosophila melanogast...    63   7e-09
UniRef50_Q9ZS84 Cluster: Polyprotein; n=1; Solanum lycopersicum|...    62   9e-09
UniRef50_Q8S653 Cluster: Putative retroelement; n=1; Oryza sativ...    62   9e-09
UniRef50_Q7XKP3 Cluster: OSJNBa0032N05.6 protein; n=3; Oryza sat...    62   9e-09
UniRef50_Q2HW78 Cluster: RNA-directed DNA polymerase; n=2; Medic...    62   9e-09
UniRef50_Q10GU0 Cluster: Retrotransposon protein, putative, Ty3-...    62   9e-09
UniRef50_Q0IR52 Cluster: Os11g0677100 protein; n=2; Oryza sativa...    62   9e-09
UniRef50_Q0DBF1 Cluster: Os06g0570000 protein; n=1; Oryza sativa...    62   9e-09
UniRef50_A5AZA3 Cluster: Putative uncharacterized protein; n=1; ...    62   9e-09
UniRef50_Q9UVC1 Cluster: Pol polyprotein; n=2; Capnodiales|Rep: ...    62   9e-09
UniRef50_P20825 Cluster: Retrovirus-related Pol polyprotein from...    62   9e-09
UniRef50_UPI00015B6135 Cluster: PREDICTED: hypothetical protein;...    62   1e-08
UniRef50_UPI0000F1F9FD Cluster: PREDICTED: similar to gag-protea...    62   1e-08
UniRef50_Q65353 Cluster: ORF B; n=7; root|Rep: ORF B - Autograph...    62   1e-08
UniRef50_Q0DJL7 Cluster: Os05g0263200 protein; n=13; Eukaryota|R...    62   1e-08
UniRef50_Q01JC4 Cluster: OSIGBa0122F23.6 protein; n=116; cellula...    62   1e-08
UniRef50_A5JSC4 Cluster: Polyprotein; n=8; Poaceae|Rep: Polyprot...    62   1e-08
UniRef50_A5BRL2 Cluster: Putative uncharacterized protein; n=1; ...    62   1e-08
UniRef50_A5ARJ4 Cluster: Putative uncharacterized protein; n=1; ...    62   1e-08
UniRef50_P34431 Cluster: Uncharacterized protein F44E2.2; n=5; C...    62   1e-08
UniRef50_UPI00015B47E1 Cluster: PREDICTED: hypothetical protein;...    62   2e-08
UniRef50_UPI00015B4428 Cluster: PREDICTED: similar to protease, ...    62   2e-08
UniRef50_UPI0000E47417 Cluster: PREDICTED: similar to transposas...    62   2e-08
UniRef50_Q7XW82 Cluster: OSJNBa0019J05.12 protein; n=8; Oryza sa...    62   2e-08
UniRef50_Q7XQR2 Cluster: OSJNBa0091D06.2 protein; n=3; Oryza sat...    62   2e-08
UniRef50_Q6L3M7 Cluster: Gag-pol protein, putative; n=4; Magnoli...    62   2e-08
UniRef50_Q2R2J9 Cluster: Retrotransposon protein, putative, Ty3-...    62   2e-08
UniRef50_Q01LW3 Cluster: OSIGBa0139I12.1 protein; n=2; Oryza sat...    62   2e-08
UniRef50_Q01JG0 Cluster: H0502G05.6 protein; n=22; root|Rep: H05...    62   2e-08
UniRef50_Q01JD2 Cluster: OSIGBa0130P02.7 protein; n=23; Oryza sa...    62   2e-08
UniRef50_A5BVZ6 Cluster: Putative uncharacterized protein; n=1; ...    62   2e-08
UniRef50_A5B4Q4 Cluster: Putative uncharacterized protein; n=13;...    62   2e-08
UniRef50_Q4QQF6 Cluster: Gag-pol polyprotein; n=3; Schistosoma|R...    62   2e-08
UniRef50_A0NFM2 Cluster: ENSANGP00000030157; n=1; Anopheles gamb...    62   2e-08
UniRef50_UPI00015B440C Cluster: PREDICTED: hypothetical protein;...    61   2e-08
UniRef50_UPI0000E47C82 Cluster: PREDICTED: similar to LReO_3; n=...    61   2e-08
UniRef50_Q7XXG1 Cluster: OSJNBb0089K24.9 protein; n=1; Oryza sat...    61   2e-08
UniRef50_Q7XL33 Cluster: OSJNBa0056L23.24 protein; n=1; Oryza sa...    61   2e-08
UniRef50_Q0KIP3 Cluster: Polyprotein, 3'-partial, putative; n=4;...    61   2e-08
UniRef50_Q0J3B5 Cluster: Os09g0135100 protein; n=1; Oryza sativa...    61   2e-08
UniRef50_A5C1Z6 Cluster: Putative uncharacterized protein; n=1; ...    61   2e-08
UniRef50_A5BTF9 Cluster: Putative uncharacterized protein; n=1; ...    61   2e-08
UniRef50_A5BSX6 Cluster: Putative uncharacterized protein; n=1; ...    61   2e-08
UniRef50_A5B9Y2 Cluster: Putative uncharacterized protein; n=1; ...    61   2e-08
UniRef50_A5AI26 Cluster: Putative uncharacterized protein; n=5; ...    61   2e-08
UniRef50_A5AG41 Cluster: Putative uncharacterized protein; n=1; ...    61   2e-08
UniRef50_Q6RYC6 Cluster: Gag-pol polyprotein; n=5; Dikarya|Rep: ...    61   2e-08
UniRef50_UPI00015B48F4 Cluster: PREDICTED: similar to protease, ...    61   3e-08
UniRef50_UPI0000F21214 Cluster: PREDICTED: similar to LReO_3; n=...    61   3e-08
UniRef50_UPI0000F1E127 Cluster: PREDICTED: similar to transposas...    61   3e-08
UniRef50_Q4EA25 Cluster: Pol protein; n=1; Wolbachia endosymbion...    61   3e-08
UniRef50_Q9ZVK4 Cluster: Putative retroelement pol polyprotein; ...    61   3e-08
UniRef50_Q7XNX7 Cluster: OSJNBb0026I12.3 protein; n=15; Magnolio...    61   3e-08
UniRef50_Q5H9W5 Cluster: B1168G10.5 protein; n=4; Oryza sativa|R...    61   3e-08
UniRef50_Q53JF2 Cluster: Retrotransposon protein, putative, Ty3-...    61   3e-08
UniRef50_A5BJ88 Cluster: Putative uncharacterized protein; n=1; ...    61   3e-08
UniRef50_A5BC35 Cluster: Putative uncharacterized protein; n=5; ...    61   3e-08
UniRef50_A5AFF2 Cluster: Putative uncharacterized protein; n=3; ...    61   3e-08
UniRef50_Q9BK97 Cluster: Reverse transcriptase-like protein; n=2...    61   3e-08
UniRef50_Q9HFY7 Cluster: Pol protein; n=1; Glomerella cingulata|...    61   3e-08
UniRef50_Q2H2Q7 Cluster: Putative uncharacterized protein; n=1; ...    61   3e-08
UniRef50_A6SRY0 Cluster: Putative uncharacterized protein; n=11;...    61   3e-08
UniRef50_A5E738 Cluster: Putative uncharacterized protein; n=7; ...    61   3e-08
UniRef50_Q7XVW4 Cluster: OSJNBa0065J03.7 protein; n=3; Oryza sat...    60   4e-08
UniRef50_Q7XLS5 Cluster: OSJNBa0057M08.11 protein; n=15; Oryza s...    60   4e-08
UniRef50_Q75G97 Cluster: Putative uncharacterized protein OSJNBa...    60   4e-08
UniRef50_Q01HB3 Cluster: OSIGBa0139N19-OSIGBa0137L10.2 protein; ...    60   4e-08
UniRef50_A5B0B1 Cluster: Putative uncharacterized protein; n=1; ...    60   4e-08
UniRef50_A5AKS9 Cluster: Putative uncharacterized protein; n=1; ...    60   4e-08
UniRef50_A2Q2J0 Cluster: RNA-directed DNA polymerase (Reverse tr...    60   4e-08
UniRef50_Q750W7 Cluster: AGL178Wp; n=1; Eremothecium gossypii|Re...    60   4e-08
UniRef50_UPI0000F1FA86 Cluster: PREDICTED: similar to transposas...    60   5e-08
UniRef50_UPI0000F1DD74 Cluster: PREDICTED: hypothetical protein;...    60   5e-08
UniRef50_Q6W3Q8 Cluster: Pol protein; n=23; Euteleostomi|Rep: Po...    60   5e-08
UniRef50_Q0Q533 Cluster: Reverse transcriptase; n=1; Phytophthor...    60   5e-08
UniRef50_Q0KIP8 Cluster: Putative uncharacterized protein; n=1; ...    60   5e-08
UniRef50_A5BYV1 Cluster: Putative uncharacterized protein; n=1; ...    60   5e-08
UniRef50_A5BPY5 Cluster: Putative uncharacterized protein; n=5; ...    60   5e-08
UniRef50_A5BI05 Cluster: Putative uncharacterized protein; n=22;...    60   5e-08
UniRef50_UPI0000F1FC2A Cluster: PREDICTED: similar to LReO_3; n=...    60   6e-08
UniRef50_UPI0000E49D32 Cluster: PREDICTED: similar to transposas...    60   6e-08
UniRef50_UPI0000E46473 Cluster: PREDICTED: similar to Os07g04442...    60   6e-08
UniRef50_Q7XKR0 Cluster: OSJNBa0053B21.11 protein; n=3; Oryza sa...    60   6e-08
UniRef50_Q53N07 Cluster: Retrotransposon protein, putative, Ty3-...    60   6e-08
UniRef50_Q2QTI9 Cluster: Retrotransposon protein, putative, Ty3-...    60   6e-08
UniRef50_Q2QSI5 Cluster: Retrotransposon protein, putative, uncl...    60   6e-08
UniRef50_Q10F38 Cluster: Retrotransposon protein, putative, uncl...    60   6e-08
UniRef50_A5C730 Cluster: Putative uncharacterized protein; n=1; ...    60   6e-08
UniRef50_A5BWM0 Cluster: Putative uncharacterized protein; n=1; ...    60   6e-08
UniRef50_A5AI18 Cluster: Putative uncharacterized protein; n=2; ...    60   6e-08
UniRef50_Q2HHU5 Cluster: Putative uncharacterized protein; n=2; ...    60   6e-08
UniRef50_UPI00015B44DF Cluster: PREDICTED: similar to protease, ...    59   8e-08
UniRef50_UPI0000F2096A Cluster: exosome component 2; n=15; Danio...    59   8e-08
UniRef50_UPI0000F1FE75 Cluster: PREDICTED: hypothetical protein;...    59   8e-08
UniRef50_Q9SHM3 Cluster: F7F22.17; n=10; Arabidopsis thaliana|Re...    59   8e-08
UniRef50_Q9FZN9 Cluster: Retroelement pol polyprotein-like; n=7;...    59   8e-08
UniRef50_Q9AXC5 Cluster: Putative uncharacterized protein; n=1; ...    59   8e-08
UniRef50_Q01N00 Cluster: OSIGBa0132I10.1 protein; n=58; Magnolio...    59   8e-08
UniRef50_A5C660 Cluster: Putative uncharacterized protein; n=2; ...    59   8e-08
UniRef50_A5C5I0 Cluster: Putative uncharacterized protein; n=17;...    59   8e-08
UniRef50_A5BXN6 Cluster: Putative uncharacterized protein; n=1; ...    59   8e-08
UniRef50_A5AZ01 Cluster: Putative uncharacterized protein; n=1; ...    59   8e-08
UniRef50_A5AVY5 Cluster: Putative uncharacterized protein; n=2; ...    59   8e-08
UniRef50_A5AHF8 Cluster: Putative uncharacterized protein; n=7; ...    59   8e-08
UniRef50_Q9NHF7 Cluster: Pol protein; n=1; Drosophila melanogast...    59   8e-08
UniRef50_A7EEI4 Cluster: Putative uncharacterized protein; n=2; ...    59   8e-08
UniRef50_A6S6Z7 Cluster: Putative uncharacterized protein; n=8; ...    59   8e-08
UniRef50_UPI00015B488C Cluster: PREDICTED: similar to protease, ...    59   1e-07
UniRef50_UPI0000F1F536 Cluster: PREDICTED: hypothetical protein;...    59   1e-07
UniRef50_UPI00015A6C6B Cluster: UPI00015A6C6B related cluster; n...    59   1e-07
UniRef50_Q946T7 Cluster: Reverse transcriptase; n=303; Magnoliop...    59   1e-07
UniRef50_Q8SB62 Cluster: Putative polyprotein; n=1; Oryza sativa...    59   1e-07
UniRef50_Q7XQR0 Cluster: OSJNBa0091D06.9 protein; n=9; Oryza sat...    59   1e-07
UniRef50_Q7XMR7 Cluster: OSJNBa0029L02.20 protein; n=2; cellular...    59   1e-07
UniRef50_Q7X639 Cluster: OSJNBb0067G11.5 protein; n=1; Oryza sat...    59   1e-07
UniRef50_Q2QTW2 Cluster: Retrotransposon protein, putative, Ty3-...    59   1e-07
UniRef50_Q01JF4 Cluster: H0502G05.12 protein; n=33; Oryza sativa...    59   1e-07
UniRef50_A5C046 Cluster: Putative uncharacterized protein; n=3; ...    59   1e-07
UniRef50_A5BYC4 Cluster: Putative uncharacterized protein; n=4; ...    59   1e-07
UniRef50_Q1RL39 Cluster: Zinc finger protein; n=1; Ciona intesti...    59   1e-07
UniRef50_UPI0000E47E9E Cluster: PREDICTED: similar to transposas...    58   1e-07
UniRef50_Q7Y006 Cluster: Putative polyprotein; n=2; Oryza sativa...    58   1e-07
UniRef50_Q2QTF6 Cluster: Retrotransposon protein, putative, Ty3-...    58   1e-07
UniRef50_Q2QPQ2 Cluster: Retrotransposon protein, putative, Ty3-...    58   1e-07
UniRef50_A5CAG9 Cluster: Putative uncharacterized protein; n=2; ...    58   1e-07
UniRef50_A5BY07 Cluster: Putative uncharacterized protein; n=3; ...    58   1e-07
UniRef50_A5BIJ0 Cluster: Putative uncharacterized protein; n=3; ...    58   1e-07
UniRef50_A5B8Y0 Cluster: Putative uncharacterized protein; n=1; ...    58   1e-07
UniRef50_A5B0Q3 Cluster: Putative uncharacterized protein; n=2; ...    58   1e-07
UniRef50_A5AZV8 Cluster: Putative uncharacterized protein; n=2; ...    58   1e-07
UniRef50_A5AJJ6 Cluster: Putative uncharacterized protein; n=4; ...    58   1e-07
UniRef50_P10401 Cluster: Retrovirus-related Pol polyprotein from...    58   1e-07
UniRef50_UPI00015B4879 Cluster: PREDICTED: similar to reverse tr...    58   2e-07
UniRef50_Q9SL06 Cluster: Putative retroelement pol polyprotein; ...    58   2e-07
UniRef50_Q9AYC2 Cluster: Polyprotein; n=37; Oryza sativa|Rep: Po...    58   2e-07
UniRef50_Q7XWM8 Cluster: OSJNBb0052B05.1 protein; n=1; Oryza sat...    58   2e-07
UniRef50_Q572G9 Cluster: Putative polyprotein; n=1; Phytophthora...    58   2e-07
UniRef50_Q53KY4 Cluster: Retrotransposon protein, putative, Ty3-...    58   2e-07
UniRef50_Q10RA2 Cluster: Retrotransposon protein, putative, uncl...    58   2e-07
UniRef50_A5C281 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_A5BRQ1 Cluster: Putative uncharacterized protein; n=4; ...    58   2e-07
UniRef50_A5BHL3 Cluster: Putative uncharacterized protein; n=5; ...    58   2e-07
UniRef50_A5BBT3 Cluster: Putative uncharacterized protein; n=4; ...    58   2e-07
UniRef50_A5B5G8 Cluster: Putative uncharacterized protein; n=2; ...    58   2e-07
UniRef50_A5ADB0 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q4QQD3 Cluster: Gag-pol polyprotein; n=3; Schistosoma|R...    58   2e-07
UniRef50_A7ED15 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_A6S8L9 Cluster: Putative uncharacterized protein; n=2; ...    58   2e-07
UniRef50_UPI0000E472F8 Cluster: PREDICTED: similar to transposas...    58   3e-07
UniRef50_Q9XIG5 Cluster: T10P12.3 protein; n=1; Arabidopsis thal...    58   3e-07
UniRef50_Q8SB13 Cluster: Putative gag-pol polyprotein; n=1; Oryz...    58   3e-07
UniRef50_Q10RT2 Cluster: Retrotransposon protein, putative, uncl...    58   3e-07
UniRef50_Q10HG0 Cluster: Retrotransposon protein, putative, uncl...    58   3e-07
UniRef50_Q0Q538 Cluster: Reverse transcriptase; n=1; Phytophthor...    58   3e-07
UniRef50_Q01L72 Cluster: H0321H01.8 protein; n=3; Eukaryota|Rep:...    58   3e-07
UniRef50_A5C995 Cluster: Putative uncharacterized protein; n=1; ...    58   3e-07
UniRef50_A5C6M0 Cluster: Putative uncharacterized protein; n=2; ...    58   3e-07
UniRef50_A5C6G8 Cluster: Putative uncharacterized protein; n=4; ...    58   3e-07
UniRef50_A5BXG2 Cluster: Putative uncharacterized protein; n=1; ...    58   3e-07
UniRef50_A5BKR4 Cluster: Putative uncharacterized protein; n=4; ...    58   3e-07
UniRef50_A5BFS9 Cluster: Putative uncharacterized protein; n=15;...    58   3e-07
UniRef50_A5AY22 Cluster: Putative uncharacterized protein; n=6; ...    58   3e-07
UniRef50_UPI00015B43B5 Cluster: PREDICTED: similar to LReO_3; n=...    57   3e-07
UniRef50_Q8UUM8 Cluster: LReO_3 protein; n=1; Oryzias latipes|Re...    57   3e-07
UniRef50_Q9SKV5 Cluster: F5J5.15; n=3; Arabidopsis thaliana|Rep:...    57   3e-07
UniRef50_Q8S8H7 Cluster: Putative retroelement pol polyprotein; ...    57   3e-07
UniRef50_Q5JPW2 Cluster: OSJNBa0085C10.29 protein; n=43; Viridip...    57   3e-07
UniRef50_Q53J49 Cluster: Retrotransposon protein, putative, Ty3-...    57   3e-07
UniRef50_Q10KN1 Cluster: Retrotransposon protein, putative, uncl...    57   3e-07
UniRef50_Q0ZCD0 Cluster: Integrase; n=1; Populus trichocarpa|Rep...    57   3e-07
UniRef50_Q0E1H7 Cluster: Os02g0442200 protein; n=1; Oryza sativa...    57   3e-07
UniRef50_Q0DHM6 Cluster: Os05g0456700 protein; n=1; Oryza sativa...    57   3e-07
UniRef50_A5BWP6 Cluster: Putative uncharacterized protein; n=1; ...    57   3e-07
UniRef50_A5BP54 Cluster: Putative uncharacterized protein; n=1; ...    57   3e-07
UniRef50_A5BBQ6 Cluster: Putative uncharacterized protein; n=2; ...    57   3e-07
UniRef50_A5AZY6 Cluster: Putative uncharacterized protein; n=5; ...    57   3e-07
UniRef50_A5ACN5 Cluster: Putative uncharacterized protein; n=6; ...    57   3e-07
UniRef50_Q5K8X3 Cluster: Retrotransposon nucleocapsid protein, p...    57   3e-07
UniRef50_Q55HB0 Cluster: Putative uncharacterized protein; n=2; ...    57   3e-07
UniRef50_Q2GZI9 Cluster: Putative uncharacterized protein; n=1; ...    57   3e-07
UniRef50_Q15F65 Cluster: Pol polyprotein; n=1; Nosema bombycis|R...    57   3e-07
UniRef50_A7TKG9 Cluster: Tkp3 protein; n=5; Vanderwaltozyma poly...    57   3e-07
UniRef50_UPI0000E4917A Cluster: PREDICTED: similar to zinc finge...    57   5e-07
UniRef50_Q7XKL8 Cluster: OSJNBa0054D14.8 protein; n=4; cellular ...    57   5e-07
UniRef50_Q0Q534 Cluster: Reverse transcriptase; n=2; Phytophthor...    57   5e-07
UniRef50_Q0D613 Cluster: Os07g0518300 protein; n=2; Oryza sativa...    57   5e-07
UniRef50_A5C043 Cluster: Putative uncharacterized protein; n=5; ...    57   5e-07
UniRef50_A5BD78 Cluster: Putative uncharacterized protein; n=1; ...    57   5e-07
UniRef50_A5BA44 Cluster: Putative uncharacterized protein; n=6; ...    57   5e-07
UniRef50_A5B6C4 Cluster: Putative uncharacterized protein; n=2; ...    57   5e-07
UniRef50_A5B3K7 Cluster: Putative uncharacterized protein; n=1; ...    57   5e-07
UniRef50_A5AVC9 Cluster: Putative uncharacterized protein; n=1; ...    57   5e-07
UniRef50_A5ASD2 Cluster: Putative uncharacterized protein; n=8; ...    57   5e-07
UniRef50_A5AKZ7 Cluster: Putative uncharacterized protein; n=1; ...    57   5e-07
UniRef50_A5AGD8 Cluster: Putative uncharacterized protein; n=3; ...    57   5e-07
UniRef50_Q94HL7 Cluster: Putative retroelement; n=1; Oryza sativ...    56   6e-07
UniRef50_Q7XRJ9 Cluster: OSJNBa0042D13.11 protein; n=1; Oryza sa...    56   6e-07
UniRef50_Q7XL81 Cluster: OSJNBb0014D23.8 protein; n=4; Oryza sat...    56   6e-07
UniRef50_Q53J91 Cluster: Retrotransposon protein, putative, Ty3-...    56   6e-07
UniRef50_A7QXC8 Cluster: Chromosome undetermined scaffold_220, w...    56   6e-07
UniRef50_A5C0Y9 Cluster: Putative uncharacterized protein; n=1; ...    56   6e-07
UniRef50_A5BZM9 Cluster: Putative uncharacterized protein; n=1; ...    56   6e-07
UniRef50_A5BW48 Cluster: Putative uncharacterized protein; n=1; ...    56   6e-07
UniRef50_A5BSN7 Cluster: Putative uncharacterized protein; n=20;...    56   6e-07
UniRef50_A5BMW4 Cluster: Putative uncharacterized protein; n=1; ...    56   6e-07
UniRef50_A5B7M5 Cluster: Putative uncharacterized protein; n=1; ...    56   6e-07
UniRef50_A5AY52 Cluster: Putative uncharacterized protein; n=1; ...    56   6e-07
UniRef50_A5ALE1 Cluster: Putative uncharacterized protein; n=1; ...    56   6e-07
UniRef50_A5AGW4 Cluster: Putative uncharacterized protein; n=1; ...    56   6e-07
UniRef50_A5AER4 Cluster: Putative uncharacterized protein; n=1; ...    56   6e-07
UniRef50_A1BPH1 Cluster: Pol polyprotein; n=4; cellular organism...    56   6e-07
UniRef50_Q9C435 Cluster: Polymerase; n=6; Magnaporthe grisea|Rep...    56   6e-07
UniRef50_Q2HHR9 Cluster: Putative uncharacterized protein; n=1; ...    56   6e-07
UniRef50_UPI00015B4B68 Cluster: PREDICTED: similar to SD02026p; ...    56   8e-07
UniRef50_Q9LPB1 Cluster: T32E20.9; n=3; Arabidopsis thaliana|Rep...    56   8e-07
UniRef50_Q8SA85 Cluster: Prpol; n=6; Andropogoneae|Rep: Prpol - ...    56   8e-07
UniRef50_Q7XBD9 Cluster: Putative gag-pol; n=34; Andropogoneae|R...    56   8e-07
UniRef50_Q5H9V4 Cluster: B1168G10.16 protein; n=2; Oryza sativa|...    56   8e-07
UniRef50_Q53JS0 Cluster: Retrotransposon protein, putative, Ty3-...    56   8e-07
UniRef50_A5C019 Cluster: Putative uncharacterized protein; n=4; ...    56   8e-07
UniRef50_A5BXQ2 Cluster: Putative uncharacterized protein; n=6; ...    56   8e-07
UniRef50_A5BCA5 Cluster: Putative uncharacterized protein; n=1; ...    56   8e-07
UniRef50_A5B903 Cluster: Putative uncharacterized protein; n=2; ...    56   8e-07
UniRef50_A5ACQ2 Cluster: Putative uncharacterized protein; n=1; ...    56   8e-07
UniRef50_UPI00005887CC Cluster: PREDICTED: similar to transposas...    56   1e-06
UniRef50_Q8SAB1 Cluster: Putative GAG-POL-orf2 protein; n=1; Sor...    56   1e-06
UniRef50_Q7XM47 Cluster: OSJNBb0018J12.12 protein; n=1; Oryza sa...    56   1e-06
UniRef50_Q339U0 Cluster: Retrotransposon protein, putative, uncl...    56   1e-06
UniRef50_Q2QVT0 Cluster: Retrotransposon protein, putative, uncl...    56   1e-06
UniRef50_Q0JI68 Cluster: Os01g0820300 protein; n=1; Oryza sativa...    56   1e-06
UniRef50_A5BX26 Cluster: Putative uncharacterized protein; n=2; ...    56   1e-06
UniRef50_A5BVP5 Cluster: Putative uncharacterized protein; n=5; ...    56   1e-06
UniRef50_A5BRI4 Cluster: Putative uncharacterized protein; n=1; ...    56   1e-06
UniRef50_A5BGM7 Cluster: Putative uncharacterized protein; n=1; ...    56   1e-06
UniRef50_A5B960 Cluster: Putative uncharacterized protein; n=1; ...    56   1e-06
UniRef50_A5AVK2 Cluster: Putative uncharacterized protein; n=1; ...    56   1e-06
UniRef50_A5AQQ3 Cluster: Putative uncharacterized protein; n=1; ...    56   1e-06
UniRef50_A5AIS2 Cluster: Putative uncharacterized protein; n=1; ...    56   1e-06
UniRef50_Q9XZR7 Cluster: Protease, reverse transcriptase, ribonu...    56   1e-06
UniRef50_O42691 Cluster: Pol-like peptide; n=1; Alternaria alter...    56   1e-06
UniRef50_UPI0000F21706 Cluster: PREDICTED: similar to retrotrans...    55   1e-06
UniRef50_UPI0000E46BC9 Cluster: PREDICTED: similar to transposas...    55   1e-06
UniRef50_Q9LH10 Cluster: Retroelement pol polyprotein-like; n=1;...    55   1e-06
UniRef50_Q9AXC3 Cluster: Putative uncharacterized protein; n=1; ...    55   1e-06
UniRef50_Q84SS5 Cluster: Putative gag-pol polyprotein; n=1; Oryz...    55   1e-06
UniRef50_Q2AA50 Cluster: Retrotransposon gag protein; n=6; Aspar...    55   1e-06
UniRef50_Q10HL1 Cluster: Retrotransposon protein, putative, Ty3-...    55   1e-06
UniRef50_Q10G32 Cluster: Retrotransposon protein, putative, Ty3-...    55   1e-06
UniRef50_Q01HL1 Cluster: H0211F06-OSIGBa0153M17.7 protein; n=2; ...    55   1e-06
UniRef50_A7QRX1 Cluster: Chromosome undetermined scaffold_153, w...    55   1e-06
UniRef50_A5C3F2 Cluster: Putative uncharacterized protein; n=1; ...    55   1e-06
UniRef50_A5BPS5 Cluster: Putative uncharacterized protein; n=1; ...    55   1e-06
UniRef50_A5B7N0 Cluster: Putative uncharacterized protein; n=21;...    55   1e-06
UniRef50_A5AZJ9 Cluster: Putative uncharacterized protein; n=2; ...    55   1e-06
UniRef50_A5AQ58 Cluster: Putative uncharacterized protein; n=1; ...    55   1e-06
UniRef50_Q6GV83 Cluster: Pol protein; n=1; Oikopleura dioica|Rep...    55   1e-06
UniRef50_A6R8M2 Cluster: Predicted protein; n=5; Ajellomyces cap...    55   1e-06
UniRef50_UPI00015B493F Cluster: PREDICTED: similar to pol protei...    55   2e-06
UniRef50_UPI00015B46CA Cluster: PREDICTED: hypothetical protein;...    55   2e-06
UniRef50_UPI0000E46419 Cluster: PREDICTED: similar to OSJNBa0011...    55   2e-06
UniRef50_Q91451 Cluster: Reverse transcriptase; n=2; Salmonidae|...    55   2e-06
UniRef50_Q6ATA9 Cluster: Putative polyprotein; n=1; Oryza sativa...    55   2e-06
UniRef50_Q2R2G1 Cluster: Retrotransposon protein, putative, uncl...    55   2e-06
UniRef50_A5BWD8 Cluster: Putative uncharacterized protein; n=1; ...    55   2e-06
UniRef50_A5BQ67 Cluster: Putative uncharacterized protein; n=1; ...    55   2e-06
UniRef50_A5B693 Cluster: Putative uncharacterized protein; n=9; ...    55   2e-06
UniRef50_A5B385 Cluster: Putative uncharacterized protein; n=2; ...    55   2e-06
UniRef50_Q9TX39 Cluster: POL protein; n=2; Deuterostomia|Rep: PO...    55   2e-06
UniRef50_Q54AL1 Cluster: Putative uncharacterized protein; n=3; ...    55   2e-06
UniRef50_Q9AVN1 Cluster: Reverse transcriptase; n=237; cellular ...    54   2e-06
UniRef50_Q6WAY3 Cluster: Gag/pol polyprotein; n=7; core eudicoty...    54   2e-06
UniRef50_Q6MWI5 Cluster: B1159F04.15 protein; n=18; Oryza sativa...    54   2e-06
UniRef50_Q2QN21 Cluster: Retrotransposon protein, putative, Ty3-...    54   2e-06
UniRef50_Q2AA38 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_Q10PF2 Cluster: Retrotransposon protein, putative, uncl...    54   2e-06
UniRef50_Q10HE7 Cluster: Retrotransposon protein, putative, Ty3-...    54   2e-06
UniRef50_Q0ZCC0 Cluster: Gag protein; n=2; Populus trichocarpa|R...    54   2e-06
UniRef50_A5BG34 Cluster: Putative uncharacterized protein; n=2; ...    54   2e-06
UniRef50_A5B1M6 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_A5AZ22 Cluster: Putative uncharacterized protein; n=4; ...    54   2e-06
UniRef50_A5API1 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_A5AH70 Cluster: Putative uncharacterized protein; n=3; ...    54   2e-06
UniRef50_Q55HC0 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_A7EEJ7 Cluster: Putative uncharacterized protein; n=4; ...    54   2e-06
UniRef50_UPI00015B4786 Cluster: PREDICTED: hypothetical protein;...    54   3e-06
UniRef50_Q946U6 Cluster: Reverse transcriptase; n=3; Oryza sativ...    54   3e-06
UniRef50_Q7XU19 Cluster: OSJNBa0091D06.19 protein; n=18; Oryza s...    54   3e-06
UniRef50_Q7XLL2 Cluster: OSJNBa0094P09.15 protein; n=2; Oryza sa...    54   3e-06
UniRef50_Q6AU30 Cluster: Putative reverse transcriptase; n=4; Or...    54   3e-06
UniRef50_Q2QWF9 Cluster: Retrotransposon protein, putative, uncl...    54   3e-06
UniRef50_Q2AAA0 Cluster: Gag-pol polyprotein, putative; n=1; Asp...    54   3e-06
UniRef50_Q25AC6 Cluster: H0522A01.4 protein; n=11; Oryza sativa|...    54   3e-06
UniRef50_Q01M31 Cluster: OSIGBa0130O15.8 protein; n=107; Oryza s...    54   3e-06
UniRef50_Q01HI2 Cluster: OSIGBa0142I02-OSIGBa0101B20.7 protein; ...    54   3e-06
UniRef50_Q01HB0 Cluster: OSIGBa0139N19-OSIGBa0137L10.5 protein; ...    54   3e-06
UniRef50_A5C622 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_A5BYY3 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_A5BFW5 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_A5BFP8 Cluster: Putative uncharacterized protein; n=4; ...    54   3e-06
UniRef50_A5B9L6 Cluster: Putative uncharacterized protein; n=2; ...    54   3e-06
UniRef50_A5AZU3 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_A5AIU0 Cluster: Putative uncharacterized protein; n=4; ...    54   3e-06
UniRef50_A5AIQ5 Cluster: Putative uncharacterized protein; n=2; ...    54   3e-06
UniRef50_Q6CHG3 Cluster: Ylt1 protein; n=6; Yarrowia lipolytica|...    54   3e-06
UniRef50_Q55ZZ2 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_Q2GUG1 Cluster: Putative uncharacterized protein; n=1; ...    54   3e-06
UniRef50_Q2GN40 Cluster: Putative uncharacterized protein; n=2; ...    54   3e-06
UniRef50_UPI0000F1FB51 Cluster: PREDICTED: hypothetical protein;...    54   4e-06
UniRef50_Q9LMV1 Cluster: F5M15.26; n=24; core eudicotyledons|Rep...    54   4e-06
UniRef50_Q9AYK7 Cluster: Putative gypsy-type retrotransposon pol...    54   4e-06
UniRef50_Q7XXG9 Cluster: OSJNBb0016B03.14 protein; n=1; Oryza sa...    54   4e-06
UniRef50_Q7XME9 Cluster: OSJNBa0061G20.10 protein; n=2; Oryza sa...    54   4e-06
UniRef50_Q53JQ8 Cluster: Retrotransposon protein, putative, Ty3-...    54   4e-06
UniRef50_Q53JA4 Cluster: Integrase core domain, putative; n=1; O...    54   4e-06
UniRef50_Q2R8I2 Cluster: Retrotransposon protein, putative, Ty3-...    54   4e-06
UniRef50_Q2R3R9 Cluster: Retrotransposon protein, putative, Ty3-...    54   4e-06
UniRef50_Q2QPT5 Cluster: Retrotransposon protein, putative, uncl...    54   4e-06
UniRef50_Q0J6J9 Cluster: Os08g0306200 protein; n=2; Oryza sativa...    54   4e-06
UniRef50_A5C2R0 Cluster: Putative uncharacterized protein; n=13;...    54   4e-06
UniRef50_A5C2G1 Cluster: Putative uncharacterized protein; n=2; ...    54   4e-06

>UniRef50_Q4SV63 Cluster: Chromosome undetermined SCAF13786, whole
           genome shotgun sequence; n=20; Tetraodontidae|Rep:
           Chromosome undetermined SCAF13786, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 1238

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 40/85 (47%), Positives = 59/85 (69%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ + D+G+++NPAKC FG   + FLG+RIS++G  P   ++Q + +FP P +V+ L+ F
Sbjct: 569 FQRLADHGLIVNPAKCQFGLQVIDFLGHRISSEGAVPLPAKVQVVAEFPRPASVKALQEF 628

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +GMVN+Y RFL  AA L  PL  A+
Sbjct: 629 LGMVNFYNRFLPRAAHLLQPLYEAL 653



 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 31/50 (62%), Positives = 39/50 (78%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DLV+ Y Q+PV  ED+ KTA+ITPFGL+EF  M FGL+ A QTFQR +D
Sbjct: 486 VDLVRGYHQVPVRAEDVPKTAVITPFGLFEFLRMPFGLKGAAQTFQRLMD 535



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +3

Query: 513 KGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           K    + WT E  + F   K +L++A L+AHP P A++ L TDAS   VGA
Sbjct: 657 KATDQVDWTAERVQAFEGAKSALANATLLAHPAPRADIALTTDASDVAVGA 707



 Score = 37.5 bits (83), Expect = 0.30
 Identities = 20/54 (37%), Positives = 29/54 (53%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLLRLL 316
           R   F F Y+DDILV S  A +H  HL  +F+RL     L++    C   L+++
Sbjct: 539 RGLTFVFVYLDDILVASPSADEHLTHLGQVFQRL-ADHGLIVNPAKCQFGLQVI 591


>UniRef50_Q4EB85 Cluster: Gag-pol polyprotein; n=1; Wolbachia
           endosymbiont of Drosophila ananassae|Rep: Gag-pol
           polyprotein - Wolbachia endosymbiont of Drosophila
           ananassae
          Length = 615

 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 38/85 (44%), Positives = 60/85 (70%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ +++Y + INP+KC FG   + FLG++I+  G +P   ++ A+ +FPLP+  + LRRF
Sbjct: 392 FEKLQEYNLTINPSKCSFGKESIEFLGHKINHQGIKPLQTKVNAITNFPLPKVAKELRRF 451

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           + M+N+YRRF+ NA + QAPLV  I
Sbjct: 452 LAMINFYRRFIPNAIQHQAPLVQLI 476



 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 35/52 (67%), Positives = 42/52 (80%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           IDL +AY QIP+ P+DI KTAI TPFGL+EF +MTFGL NA QTFQR++  A
Sbjct: 309 IDLNRAYNQIPIEPKDIPKTAITTPFGLFEFTHMTFGLCNAAQTFQRYMHTA 360



 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 30/52 (57%), Positives = 38/52 (73%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           TPI WT E  + FN+CK+SL+ AAL+AHP PNA L L TDAS+  VGA  ++
Sbjct: 485 TPINWTTETIDKFNSCKNSLAQAALLAHPAPNANLSLSTDASNIAVGAVLHQ 536



 Score = 41.5 bits (93), Expect = 0.018
 Identities = 21/47 (44%), Positives = 28/47 (59%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           R  DF F YVDDI V S +  QH  HLR +F++L+   +L I  + C
Sbjct: 362 RDLDFVFVYVDDIAVASANIQQHHIHLRQVFEKLQ-EYNLTINPSKC 407


>UniRef50_UPI00015B4A3C Cluster: PREDICTED: similar to pol
           polyprotein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to pol polyprotein - Nasonia vitripennis
          Length = 1359

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 39/81 (48%), Positives = 53/81 (65%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+A+    + +N +KC FG P+  FLG  +S DG  PP  +++A+K +P P T   LRRF
Sbjct: 685 FEALRQANLKVNASKCTFGQPQALFLGYEVSKDGFNPPPTKVEAIKAYPEPTTATELRRF 744

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G+ NYYRR L NAA  QAPL
Sbjct: 745 LGVCNYYRRCLPNAAANQAPL 765



 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 30/51 (58%), Positives = 36/51 (70%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           TIDL KA+ QIP+  E I KTA+ TP GLYEF   + GL+NA QT QR +D
Sbjct: 601 TIDLRKAFYQIPIDEESIEKTAVTTPIGLYEFLGTSLGLKNATQTMQRAMD 651



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 3/58 (5%)
 Frame = +3

Query: 513 KGLTP---ITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           KGLT    + WT E ++ F  CK S++ AA      P+A L L TDAS   +GA   +
Sbjct: 770 KGLTKRAKLKWTEEAKQAFQLCKASIADAACTTFFNPDAALALRTDASDIAIGAAIEQ 827



 Score = 37.9 bits (84), Expect = 0.22
 Identities = 20/47 (42%), Positives = 26/47 (55%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           R   F  AYVDDI V S D  +H  HLR LF+ L+   +L +  + C
Sbjct: 655 RKLPFAKAYVDDIFVASNDHEEHHQHLRQLFEALR-QANLKVNASKC 700


>UniRef50_UPI00015B43DC Cluster: PREDICTED: similar to gag-pol
           polyprotein; n=2; Nasonia vitripennis|Rep: PREDICTED:
           similar to gag-pol polyprotein - Nasonia vitripennis
          Length = 1331

 Score = 89.8 bits (213), Expect = 5e-17
 Identities = 37/81 (45%), Positives = 54/81 (66%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  +    + +NP KC+ G  +VT+LG  +SA+G++PP  RI A++ FP P     LRRF
Sbjct: 691 FDVLRAASMKVNPDKCILGKKQVTYLGYEVSAEGSRPPQNRIDAIQAFPKPSNTSQLRRF 750

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G++NYYRR +  AA+L APL
Sbjct: 751 LGLINYYRRCIPGAARLLAPL 771



 Score = 69.7 bits (163), Expect = 6e-11
 Identities = 31/51 (60%), Positives = 40/51 (78%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL KA+ Q+P+APED  KTAIITPFG++EF   + GLRNA Q+ QR +D+
Sbjct: 608 IDLKKAFYQLPLAPEDAHKTAIITPFGVFEFTRSSLGLRNAAQSLQRAMDQ 658



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 19/49 (38%), Positives = 29/49 (59%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLV 301
           R   F  AY+DDI+V S  A +HA HL+ LF  L+   S+ +  + C++
Sbjct: 661 RDLPFARAYLDDIIVASTSAEEHAEHLKKLFDVLR-AASMKVNPDKCIL 708



 Score = 34.3 bits (75), Expect = 2.8
 Identities = 13/23 (56%), Positives = 17/23 (73%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAA 593
           PITWTP  ++ F ACK +L+ AA
Sbjct: 787 PITWTPAAKDAFVACKSALAQAA 809


>UniRef50_UPI00015B44BD Cluster: PREDICTED: similar to gag-pol
           polyprotein; n=2; Nasonia vitripennis|Rep: PREDICTED:
           similar to gag-pol polyprotein - Nasonia vitripennis
          Length = 912

 Score = 89.4 bits (212), Expect = 7e-17
 Identities = 39/81 (48%), Positives = 56/81 (69%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  + +  I +NP KCV G  EVT+LG  +SA G++PP++R++ ++ FP P   +  RRF
Sbjct: 714 FTTLREARIKVNPDKCVLGKREVTYLGYVVSASGSRPPADRVEVVRAFPQPLDPKQFRRF 773

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           IG+VNYYRR +  AA+L APL
Sbjct: 774 IGLVNYYRRCIPGAARLMAPL 794



 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 32/50 (64%), Positives = 39/50 (78%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           IDL KA+ Q+P+APEDI KTAI TPFGL+EF   + GLRNA Q+ QR +D
Sbjct: 631 IDLKKAFYQLPIAPEDIHKTAITTPFGLFEFTRSSLGLRNAAQSLQRAMD 680



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           R+  F  AY+DDI+V S    +H  HLR LF  L+
Sbjct: 684 RNLPFARAYLDDIIVASNGPEEHLQHLRALFTTLR 718


>UniRef50_UPI00015B4898 Cluster: PREDICTED: similar to gag-pol
           polyprotein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to gag-pol polyprotein - Nasonia vitripennis
          Length = 1104

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 39/81 (48%), Positives = 53/81 (65%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+A+    I +N +KC FG P+  FLG  I+ DG +PP  +++A+K +P P T   LRRF
Sbjct: 639 FEALRQANIKVNASKCTFGQPQALFLGYEITKDGFKPPPAKVEAIKAYPEPTTATELRRF 698

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G+ NYYRR L NAA  QA L
Sbjct: 699 LGVCNYYRRCLPNAANNQASL 719



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 22/32 (68%), Positives = 25/32 (78%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEF 98
           TIDL KA+ QIP+  E I KTA+ TPFGLYEF
Sbjct: 572 TIDLRKAFYQIPIDEESIEKTAVTTPFGLYEF 603



 Score = 36.3 bits (80), Expect = 0.69
 Identities = 17/31 (54%), Positives = 20/31 (64%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F  AYVDDI V S D  +H  HLR LF+ L+
Sbjct: 613 FAKAYVDDIFVASNDHEEHLHHLRQLFEALR 643


>UniRef50_UPI00015B47EB Cluster: PREDICTED: similar to pol
           polyprotein; n=3; Nasonia vitripennis|Rep: PREDICTED:
           similar to pol polyprotein - Nasonia vitripennis
          Length = 1459

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 38/81 (46%), Positives = 54/81 (66%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  +    I +NP KCV G  +VT+LG  +SA+G++PP +RI A++ FP P     LRR 
Sbjct: 650 FDVLRAANIKVNPEKCVLGKKQVTYLGYLVSAEGSRPPQDRIDAIQAFPKPGNSAQLRRL 709

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G++NYYRR +  AA+L APL
Sbjct: 710 LGLINYYRRCIPGAARLLAPL 730



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 30/51 (58%), Positives = 39/51 (76%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL KA+ Q+P+APED  KTAIITPFGL+EF   + GLR A Q+ QR +D+
Sbjct: 567 VDLKKAFYQLPIAPEDAHKTAIITPFGLFEFTRSSLGLRYAAQSLQRAMDQ 617



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 23/55 (41%), Positives = 30/55 (54%)
 Frame = +3

Query: 513 KGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           K   PITWTP  EE F+ACK +L++AA       +A   L  DAS   +GA   +
Sbjct: 741 KKAIPITWTPAAEEAFSACKRALANAASTTFLRDDAPRRLLADASDHAIGAALEQ 795



 Score = 37.9 bits (84), Expect = 0.22
 Identities = 18/49 (36%), Positives = 28/49 (57%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLV 301
           R   F  AY+DDI+V S +  +H  HLRTLF  L+   ++ +    C++
Sbjct: 620 RDLPFARAYLDDIIVASNNEEEHVGHLRTLFDVLR-AANIKVNPEKCVL 667


>UniRef50_Q9BM80 Cluster: Gag-pol polyprotein; n=15; Bilateria|Rep:
           Gag-pol polyprotein - Clonorchis sinensis
          Length = 1311

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 43/115 (37%), Positives = 65/115 (56%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ +  Y I +N  KC+FG   + FLG+ I + G  P   RI AL+ FP+P T+  LRRF
Sbjct: 624 FERLSTYSIRLNIDKCLFGVTSLDFLGHHIDSTGISPLPNRILALESFPIPTTLTQLRRF 683

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNALMPVKIACHL 588
           IG++NYYRRF+ + A +  PL + +   E  V+  S+   + + A   +  A  L
Sbjct: 684 IGIINYYRRFIPHCADILQPLTDLLGCKEKSVTLPSVAIAAFERAKQAIAHATKL 738



 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 37/51 (72%), Positives = 42/51 (82%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DLV+AY  IPVAP+DI KTAI TPF L+EF  M FGLRNA QTFQRF+DE
Sbjct: 541 LDLVRAYYHIPVAPDDIPKTAITTPFDLFEFTRMPFGLRNAAQTFQRFMDE 591



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 21/48 (43%), Positives = 31/48 (64%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACL 298
           R   F +AY+DD+L+ S    +HAAHLR +F+RL  T S+ +  + CL
Sbjct: 594 RGLPFVYAYLDDVLIASTSPTEHAAHLRAVFERLS-TYSIRLNIDKCL 640


>UniRef50_UPI00015B479F Cluster: PREDICTED: similar to gag-pol
            polyprotein; n=3; Nasonia vitripennis|Rep: PREDICTED:
            similar to gag-pol polyprotein - Nasonia vitripennis
          Length = 1557

 Score = 85.0 bits (201), Expect = 1e-15
 Identities = 36/78 (46%), Positives = 56/78 (71%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            +++Y + +N  KC  G  E+ FLG+ I+ +G +P  E+++A++ FPLPQT++ LRRF+G+
Sbjct: 790  LKEYELQVNLEKCSLGVSELVFLGHLITPNGFKPSPEKVKAVQGFPLPQTIEELRRFLGL 849

Query: 433  VNYYRRFLRNAAKLQAPL 486
            VN YRR L +AA  Q PL
Sbjct: 850  VNSYRRLLAHAADTQRPL 867



 Score = 82.6 bits (195), Expect = 8e-15
 Identities = 39/52 (75%), Positives = 43/52 (82%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           +DL +AY QIPVA EDI KTAIITPFGLYEF  MTFG RNA QTFQR+I+ A
Sbjct: 704 LDLRQAYHQIPVAREDIPKTAIITPFGLYEFPVMTFGFRNASQTFQRYINSA 755



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 25/55 (45%), Positives = 31/55 (56%)
 Frame = +3

Query: 513  KGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
            K   P+ WTPE E  F  CK+ L + A  A P  NAEL L TDAS + +GA   +
Sbjct: 877  KDKRPVPWTPEAEAAFQKCKEDLINLAFTAFPCENAELRLITDASDTAMGAALEQ 931



 Score = 37.9 bits (84), Expect = 0.22
 Identities = 19/52 (36%), Positives = 27/52 (51%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLLRLLF 319
           DF F Y+DDIL+ S    +H  HL  +  RLK  E  +  +   L +  L+F
Sbjct: 760 DFVFVYIDDILIASTTEEEHQKHLEIVLNRLKEYELQVNLEKCSLGVSELVF 811


>UniRef50_UPI00015B4618 Cluster: PREDICTED: similar to Gag and Pol,
            partial; n=2; Nasonia vitripennis|Rep: PREDICTED: similar
            to Gag and Pol, partial - Nasonia vitripennis
          Length = 1574

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 39/52 (75%), Positives = 43/52 (82%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
            +DL +AY QIPVAPED+ KTAIITPFGLYEF  MTFG RNA QTFQR+I  A
Sbjct: 954  LDLRQAYHQIPVAPEDVPKTAIITPFGLYEFLVMTFGFRNASQTFQRYIHSA 1005


>UniRef50_UPI00015B47F6 Cluster: PREDICTED: similar to pol
            polyprotein; n=8; Nasonia vitripennis|Rep: PREDICTED:
            similar to pol polyprotein - Nasonia vitripennis
          Length = 1612

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 38/52 (73%), Positives = 45/52 (86%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
            +DL KA+ QIP+APEDI KTAIITPFGL+EF +M FGLRNA QTFQR+I+ A
Sbjct: 870  LDLHKAFNQIPIAPEDIEKTAIITPFGLFEFLFMPFGLRNASQTFQRYINRA 921



 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 35/81 (43%), Positives = 53/81 (65%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F+ ++ + + +N  K VF   E+ FLG  I++ G +P   +I A+ +FP P+T+  LRRF
Sbjct: 953  FERLKKFHLRLNVDKSVFMVEELEFLGYLINSHGIRPTRAKIDAVLNFPKPRTIVELRRF 1012

Query: 424  IGMVNYYRRFLRNAAKLQAPL 486
            +GMVN+Y R L +AA  QAPL
Sbjct: 1013 LGMVNFYHRNLPHAATSQAPL 1033



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/46 (43%), Positives = 27/46 (58%)
 Frame = +3

Query: 528  ITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            I WTPE +E F   +   + AAL+ HP   A+L + +DAS   VGA
Sbjct: 1048 IQWTPEADEAFEKVRSEFAEAALLVHPRSGADLRIVSDASDFAVGA 1093



 Score = 40.7 bits (91), Expect = 0.032
 Identities = 17/32 (53%), Positives = 23/32 (71%)
 Frame = +2

Query: 164  DFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            DF + Y+DDIL+ S    QH  +LRT+F+RLK
Sbjct: 926  DFVYIYIDDILIASDSREQHQKYLRTVFERLK 957


>UniRef50_UPI00015B5919 Cluster: PREDICTED: similar to pol
           polyprotein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to pol polyprotein - Nasonia vitripennis
          Length = 1302

 Score = 82.6 bits (195), Expect = 8e-15
 Identities = 37/52 (71%), Positives = 43/52 (82%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           +DL +AY QIPVAPED+ KTAIITPFG+YEF  MTFG RNA QTFQR+ + A
Sbjct: 431 LDLRQAYHQIPVAPEDVHKTAIITPFGVYEFPVMTFGFRNASQTFQRYTNSA 482



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 25/66 (37%), Positives = 45/66 (68%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + +Y + +N  KC  G  E+ FLG+ I+ +G +P  E+++A+++FP P T++  RRF+ +
Sbjct: 517 LNEYELQVNLEKCSLGVTELIFLGHLITPNGFKPSPEKVKAVQEFPKPWTIEEFRRFLDL 576

Query: 433 VNYYRR 450
           VN YR+
Sbjct: 577 VNSYRQ 582


>UniRef50_Q6IFT8 Cluster: Pol polyprotein; n=1; Schistosoma
           mansoni|Rep: Pol polyprotein - Schistosoma mansoni
           (Blood fluke)
          Length = 1166

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 40/50 (80%), Positives = 42/50 (84%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           IDLV+AY QIPVA EDI KTAI TPFGL+EF  M FGLRNA QTFQRFID
Sbjct: 350 IDLVRAYHQIPVALEDIEKTAITTPFGLFEFLRMPFGLRNAAQTFQRFID 399



 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 32/85 (37%), Positives = 57/85 (67%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ + D GI++NP KC  G  E+ FLG+ I  +G  P  ++++ + ++ +P T++ L+ F
Sbjct: 433 FQRLSDNGIIVNPDKCELGKKEMKFLGHVIKHEGILPCEDKVRTIMEYTVPSTLKELKAF 492

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+VN+YRRF+ +AA+   PL + +
Sbjct: 493 LGLVNFYRRFISHAAEQLRPLTDLL 517



 Score = 36.7 bits (81), Expect = 0.52
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           R  DF   Y+DD+L+ S +  +H  H+  LF+RL     +++  + C
Sbjct: 403 RDLDFVHVYIDDLLIASSNVDEHYQHMTLLFQRLS-DNGIIVNPDKC 448



 Score = 36.3 bits (80), Expect = 0.69
 Identities = 16/46 (34%), Positives = 24/46 (52%)
 Frame = +3

Query: 528 ITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           + W       F+  K +L+ A L+ HP P+A L +  DAS   +GA
Sbjct: 524 LEWNDAARTAFSDIKTALAQATLLVHPDPSATLSIAVDASDFAIGA 569


>UniRef50_A0ND95 Cluster: ENSANGP00000030414; n=6; Bilateria|Rep:
           ENSANGP00000030414 - Anopheles gambiae str. PEST
          Length = 408

 Score = 81.8 bits (193), Expect = 1e-14
 Identities = 33/71 (46%), Positives = 51/71 (71%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  + +Y + I P+KCV G   + FL + ISA+G  P +++++A+K FP P++V+ L+RF
Sbjct: 329 FNRLAEYDLKIKPSKCVLGVSTINFLSHTISANGIIPCADKVEAIKTFPTPKSVKQLQRF 388

Query: 424 IGMVNYYRRFL 456
           +GMVNYY RFL
Sbjct: 389 VGMVNYYHRFL 399



 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 34/50 (68%), Positives = 42/50 (84%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +D+V+AY  IPVA EDI KTAI TPFG++EF  M FGL+NAGQTFQRF++
Sbjct: 246 LDIVRAYHMIPVAEEDIHKTAITTPFGMFEFLRMPFGLKNAGQTFQRFMN 295



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 18/45 (40%), Positives = 25/45 (55%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLV 301
           F F Y+DDIL+ S     H  HLR +F RL     L I+ + C++
Sbjct: 303 FVFVYIDDILIASPTKETHLEHLRIVFNRL-AEYDLKIKPSKCVL 346


>UniRef50_UPI00015B4478 Cluster: PREDICTED: similar to pol
           polyprotein; n=2; Nasonia vitripennis|Rep: PREDICTED:
           similar to pol polyprotein - Nasonia vitripennis
          Length = 613

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 37/50 (74%), Positives = 43/50 (86%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           + L +AY QIPVAPEDI KTA+ITPFGLYEF+ MTFG RNA QTFQR+I+
Sbjct: 258 LHLRQAYHQIPVAPEDIPKTAVITPFGLYEFSIMTFGPRNASQTFQRYIN 307



 Score = 76.2 bits (179), Expect = 7e-13
 Identities = 31/75 (41%), Positives = 54/75 (72%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + ++ + +N  KC  G  E+ FLG+ I+++G +P  E+++A+ DFPLP+T++ LRRF+G 
Sbjct: 344 LNEHELQVNLEKCSLGVSELIFLGHLITSNGFKPNPEKVKAVNDFPLPKTIERLRRFLGP 403

Query: 433 VNYYRRFLRNAAKLQ 477
           VN Y+R L ++A+ Q
Sbjct: 404 VNSYKRLLAHSAETQ 418



 Score = 40.7 bits (91), Expect = 0.032
 Identities = 20/43 (46%), Positives = 24/43 (55%)
 Frame = +3

Query: 537 TPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           T + E  F  CKD L S    A P  NAEL L +DAS + +GA
Sbjct: 417 TQQAEAAFQKCKDDLVSLTFTAFPNENAELRLISDASDTAMGA 459



 Score = 39.1 bits (87), Expect = 0.097
 Identities = 19/52 (36%), Positives = 27/52 (51%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLLRLLF 319
           DF F Y+DDIL+ S    +H  HL T+  RL   E  +  +   L +  L+F
Sbjct: 314 DFVFVYIDDILIASTSEEEHKKHLETVLSRLNEHELQVNLEKCSLGVSELIF 365


>UniRef50_UPI0000E4A4EC Cluster: PREDICTED: similar to gag-pol
           polyprotein; n=6; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to gag-pol polyprotein -
           Strongylocentrotus purpuratus
          Length = 787

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 37/53 (69%), Positives = 42/53 (79%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEAT 164
           IDL++AY QIPV P DI KTAI TPFGL+EF  M FGLRNA QTFQR +D+ T
Sbjct: 562 IDLIRAYHQIPVEPSDIHKTAITTPFGLFEFVRMPFGLRNAAQTFQRLMDDVT 614



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 19/41 (46%), Positives = 33/41 (80%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSER 366
           F  +++YGI++NPAKC FG P ++FLG+++ ++G QP S++
Sbjct: 645 FDRLQEYGIILNPAKCQFGVPLLSFLGHKVDSEGIQPLSDK 685



 Score = 37.1 bits (82), Expect = 0.39
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           R   F + Y+DDILV S    +H  HLR LF RL+
Sbjct: 615 RGLPFVYVYLDDILVASTTKDEHETHLRLLFDRLQ 649


>UniRef50_UPI00015B5276 Cluster: PREDICTED: hypothetical protein;
           n=2; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 1403

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 31/84 (36%), Positives = 56/84 (66%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + + +  + + P KC     EVT+LG++I+ DG QP  ++++A+K FP P+ V+ +R+F+
Sbjct: 468 ERLREANLKLQPDKCEILKQEVTYLGHKINKDGLQPDPKKVEAVKHFPTPKAVKNIRQFL 527

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G+  YYRRF+++ AK+  PL   +
Sbjct: 528 GLAGYYRRFIKDFAKIAKPLTKLL 551



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 22/50 (44%), Positives = 28/50 (56%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           T+D    + QI + PED  KTA     G +EF  M FGLRNA   +QR +
Sbjct: 381 TLDCFSGFHQIMMDPEDAAKTAFSNQLGHFEFVRMPFGLRNAAAEYQRLM 430


>UniRef50_UPI00015B4703 Cluster: PREDICTED: similar to gag-pol
           polyprotein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to gag-pol polyprotein - Nasonia vitripennis
          Length = 1055

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 34/78 (43%), Positives = 54/78 (69%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + +Y + +N  KC  G  E+ FLG+ I+  G +P  E+++A+++FP P+T++ LRRF+G+
Sbjct: 542 LNEYELQVNLEKCSLGVTELIFLGHLITPKGFKPSPEKVKAVQEFPKPRTIEELRRFLGL 601

Query: 433 VNYYRRFLRNAAKLQAPL 486
           VN YRR L +AA  Q PL
Sbjct: 602 VNSYRRLLAHAADTQRPL 619



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 24/31 (77%), Positives = 27/31 (87%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEF 98
           +DL +AY QI VAPED+ KTAIITPFGLYEF
Sbjct: 501 LDLRQAYHQISVAPEDVPKTAIITPFGLYEF 531



 Score = 40.7 bits (91), Expect = 0.032
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +3

Query: 513 KGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           K   P+ WT E +  F   K  L + +  A P  N EL L TDAS + +GA   +
Sbjct: 629 KDKRPVPWTSEAKAAFQKYKVDLVNLSFTAFPSENGELRLITDASETAMGAALEQ 683


>UniRef50_UPI0000F1F2AF Cluster: PREDICTED: similar to pol
           polyprotein; n=1; Danio rerio|Rep: PREDICTED: similar to
           pol polyprotein - Danio rerio
          Length = 889

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 35/82 (42%), Positives = 55/82 (67%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q + + G+ +   KCVF A  V FLG+ +S +G +   E+IQA+ ++P P + + L+RF+
Sbjct: 467 QRLLENGLYVKAEKCVFHAQSVQFLGHIVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFL 526

Query: 427 GMVNYYRRFLRNAAKLQAPLVN 492
           G  N+YRRF+RN ++L APL N
Sbjct: 527 GFANFYRRFIRNFSQLAAPLTN 548



 Score = 37.5 bits (83), Expect = 0.30
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACL 298
           V+ + R   D F + Y+DDIL++S    +H  H+R + +RL +   L ++   C+
Sbjct: 429 VNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRL-LENGLYVKAEKCV 482



 Score = 34.3 bits (75), Expect = 2.8
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +3

Query: 45  PEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           P D  KTA  TP G +E+  + FGL NA   FQ  +++
Sbjct: 394 PGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVND 431


>UniRef50_UPI00015B47AA Cluster: PREDICTED: similar to pol
           polyprotein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to pol polyprotein - Nasonia vitripennis
          Length = 1193

 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 35/73 (47%), Positives = 52/73 (71%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           + IN AKCV G  EV FLG  +S  G +P  +++ A++ FP P++ + LRRF+GM+N+YR
Sbjct: 506 LTINLAKCVLGQQEVDFLGFTVSNQGFKPLEKKVDAIRSFPKPESPKALRRFLGMLNFYR 565

Query: 448 RFLRNAAKLQAPL 486
           R + +AA+ QAPL
Sbjct: 566 RCIPHAAQQQAPL 578



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 20/50 (40%), Positives = 26/50 (52%)
 Frame = +3

Query: 528 ITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           + WTPE E  F A K SL+ A+   +  P A L L TDAS   +G    +
Sbjct: 593 LKWTPEAETAFEAAKASLAGASRACYLSPTAPLALATDASDIAIGTALEQ 642



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 24/49 (48%), Positives = 30/49 (61%), Gaps = 4/49 (8%)
 Frame = +2

Query: 125 RRPNVSKI---YR-RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           R+PN S I   Y  R   F  AY+DDILV SR+  +H  HLR L +RL+
Sbjct: 454 RKPNASTIPDRYGFRDLPFTRAYIDDILVMSRNHEEHLQHLRALLERLR 502


>UniRef50_UPI00015B45E6 Cluster: PREDICTED: similar to gag-pol
           polyprotein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to gag-pol polyprotein - Nasonia vitripennis
          Length = 816

 Score = 80.2 bits (189), Expect = 4e-14
 Identities = 37/52 (71%), Positives = 42/52 (80%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           +DL + Y  IPVAPEDI KTA+ITPFGLYEF  MTF LRNA QTFQR+I+ A
Sbjct: 256 LDLRQVYHHIPVAPEDIPKTAVITPFGLYEFPVMTFCLRNASQTFQRYINSA 307



 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 31/78 (39%), Positives = 52/78 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + ++ + +N  KC  G  E+ FLG+ I+ +G +P  E+++A+  FPLP+T++ LRRF  +
Sbjct: 342 LNEHELQVNLEKCSLGVSELIFLGHLITPNGFKPNPEKVKAINSFPLPKTIEELRRF--L 399

Query: 433 VNYYRRFLRNAAKLQAPL 486
           VN YRR L ++A+ Q  L
Sbjct: 400 VNSYRRLLAHSAETQRHL 417



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 24/55 (43%), Positives = 30/55 (54%)
 Frame = +3

Query: 513 KGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           K   P+ WT E E  F  CKD L S +  A P  NAEL L +DAS + +GA   +
Sbjct: 427 KDKRPVPWTKEAEAAFQKCKDDLVSLSFTAFPSENAELRLISDASDTAMGAALEQ 481



 Score = 38.3 bits (85), Expect = 0.17
 Identities = 19/52 (36%), Positives = 27/52 (51%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLLRLLF 319
           DF F Y+DDIL+ S    +H  HL T+  RL   E  +  +   L +  L+F
Sbjct: 312 DFVFVYLDDILIASTSEEEHKKHLETVLSRLNEHELQVNLEKCSLGVSELIF 363


>UniRef50_UPI00015B4374 Cluster: PREDICTED: similar to gag-pol
           polyprotein; n=2; Nasonia vitripennis|Rep: PREDICTED:
           similar to gag-pol polyprotein - Nasonia vitripennis
          Length = 1189

 Score = 79.8 bits (188), Expect = 6e-14
 Identities = 37/73 (50%), Positives = 50/73 (68%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           + IN AKCV G  +V FLG  +S    QPP E+I A   FP P++ + LRRF+GM+N+YR
Sbjct: 681 LTINLAKCVLGQQKVDFLGFTVSNQVFQPPEEKIDASHSFPKPESPKALRRFLGMLNFYR 740

Query: 448 RFLRNAAKLQAPL 486
           R + +AA+ QAPL
Sbjct: 741 RCIPHAAQQQAPL 753



 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 34/50 (68%), Positives = 41/50 (82%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           IDL KAY Q+P+ P DICKTA+ TPFGL+EF  ++ GLRNA QTFQRF+D
Sbjct: 590 IDLEKAYYQVPMDPRDICKTAVATPFGLFEFCTLSLGLRNATQTFQRFMD 639



 Score = 39.5 bits (88), Expect = 0.074
 Identities = 18/35 (51%), Positives = 23/35 (65%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           R   F  AY+DDILV SR+  +H  HLR L +RL+
Sbjct: 643 RDLPFTRAYIDDILVMSRNHEEHLQHLRALLERLR 677


>UniRef50_UPI00015B43B7 Cluster: PREDICTED: similar to gag-pol
           polyprotein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to gag-pol polyprotein - Nasonia vitripennis
          Length = 363

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 36/52 (69%), Positives = 42/52 (80%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           +DL +AY QIPVAP+ + KTAIITPFGLYEF  MTF  RNA QTFQR+I+ A
Sbjct: 200 LDLRQAYHQIPVAPKGVPKTAIITPFGLYEFPVMTFAFRNASQTFQRYINSA 251



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 27/67 (40%), Positives = 44/67 (65%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + +Y + +N  KC  G  E+ FLG+ I+ +G     E+++ +++FP PQT + LRRF+G+
Sbjct: 286 LNEYELQVNLEKCSLGVTELIFLGHLITPNGYNSNLEKVKFVQEFPKPQTNKELRRFLGL 345

Query: 433 VNYYRRF 453
           VN YR F
Sbjct: 346 VNSYRHF 352



 Score = 35.9 bits (79), Expect = 0.91
 Identities = 21/70 (30%), Positives = 31/70 (44%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLLRLLFSETEYPPT 343
           DF F Y+DDIL+ S    +H  HL  +  RL   E  +  +   L +  L+F      P 
Sbjct: 256 DFVFVYLDDILIASTSEDRHQKHLDIVLSRLNEYELQVNLEKCSLGVTELIFLGHLITPN 315

Query: 344 EHNHHQSAFK 373
            +N +    K
Sbjct: 316 GYNSNLEKVK 325


>UniRef50_UPI0000E47AD9 Cluster: PREDICTED: similar to gag-pol
           polyprotein, partial; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to gag-pol
           polyprotein, partial - Strongylocentrotus purpuratus
          Length = 484

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 36/53 (67%), Positives = 41/53 (77%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEAT 164
           IDL++AY QIPV P DI KTAI TPFGL+EF  M FGLRNA +TFQR +D  T
Sbjct: 123 IDLIRAYDQIPVEPSDIPKTAITTPFGLFEFVRMPFGLRNAAKTFQRLMDNVT 175



 Score = 37.1 bits (82), Expect = 0.39
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           R + F + Y+DDILV S    +H  HLR  F RL+
Sbjct: 176 RGFPFVYVYLDDILVASTTKYEHETHLRLPFDRLQ 210


>UniRef50_UPI0000F1FB27 Cluster: PREDICTED: similar to novel
           transposon; n=3; Danio rerio|Rep: PREDICTED: similar to
           novel transposon - Danio rerio
          Length = 1257

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 33/78 (42%), Positives = 55/78 (70%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC F   EV FLG+RISA G QP +E++QA+++ P+PQTV  L+ ++G+
Sbjct: 544 LKSSGLRLKRSKCEFLGEEVVFLGHRISAAGVQPDAEKVQAIQEAPMPQTVSELKAYLGL 603

Query: 433 VNYYRRFLRNAAKLQAPL 486
           +NYY +F+   + + APL
Sbjct: 604 LNYYHKFVPILSTVLAPL 621



 Score = 36.7 bits (81), Expect = 0.52
 Identities = 22/48 (45%), Positives = 25/48 (52%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           T  TW  E EE F   K+ L S+AL+ H  P   L L  DAS   VGA
Sbjct: 629 TKWTWGSEQEESFAKSKELLQSSALLVHYDPTKPLILACDASPYGVGA 676


>UniRef50_UPI0000F1F6B2 Cluster: PREDICTED: similar to pol
           polyprotein; n=12; Danio rerio|Rep: PREDICTED: similar
           to pol polyprotein - Danio rerio
          Length = 1635

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 33/80 (41%), Positives = 54/80 (67%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q + + G+ +   KCVF A  V FLG+ +S +G +   E+I+A+ ++P P + + L+RF+
Sbjct: 701 QRLLENGLYVKAEKCVFHAQSVPFLGHIVSVEGLRMDPEKIKAVVNWPTPDSRKALQRFL 760

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G  N+YRRF+RN ++L APL
Sbjct: 761 GFANFYRRFIRNFSQLAAPL 780



 Score = 40.3 bits (90), Expect = 0.042
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL  AY  + +   D  K+A  TP G +E+  + FGL NA   FQ F+++
Sbjct: 615 LDLRNAYHLVRIRAGDEWKSAFNTPRGHFEYCVLPFGLSNAPAVFQAFVND 665



 Score = 37.5 bits (83), Expect = 0.30
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACL 298
           V+ + R   D F + Y+DDIL++S    +H  H+R + +RL +   L ++   C+
Sbjct: 663 VNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRL-LENGLYVKAEKCV 716


>UniRef50_UPI0000F1F14F Cluster: PREDICTED: similar to pol
           polyprotein; n=1; Danio rerio|Rep: PREDICTED: similar to
           pol polyprotein - Danio rerio
          Length = 1287

 Score = 76.6 bits (180), Expect = 5e-13
 Identities = 35/89 (39%), Positives = 58/89 (65%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q + +  + +   KC F    VTFLG  ISA+G +P   +++A+  +P+P T + L+RF+
Sbjct: 597 QRLLENQLFVKAEKCEFHTKSVTFLGYVISAEGIKPDIAKVRAVAKWPVPNTRKALQRFL 656

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAIVATEV 513
           G  N+YRRF+RN +++ APL  A+ +T+V
Sbjct: 657 GFANFYRRFIRNFSQIAAPL-TALTSTKV 684



 Score = 35.9 bits (79), Expect = 0.91
 Identities = 15/43 (34%), Positives = 24/43 (55%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           F F Y+DDIL++S     H  H+R + +RL +   L ++   C
Sbjct: 570 FVFVYLDDILIFSSSLQAHTHHVRQVLQRL-LENQLFVKAEKC 611



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = +3

Query: 21  AYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           A++ +  A  D  KTA  TP G +E+  + FGL NA   FQ  +++
Sbjct: 516 AFELLQGAQGDEWKTAFNTPTGHFEYLVLPFGLTNAPAVFQALVND 561


>UniRef50_Q5JPZ2 Cluster: OSJNBa0004L19.22 protein; n=8; Oryza
            sativa|Rep: OSJNBa0004L19.22 protein - Oryza sativa
            (Rice)
          Length = 1586

 Score = 75.8 bits (178), Expect = 9e-13
 Identities = 31/80 (38%), Positives = 51/80 (63%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            + +E+  +V+   KC FG P VT+LG+ IS DG     ++++ +  +P P++V  LR+F+
Sbjct: 862  KVLEENKLVVKLKKCAFGLPSVTYLGHIISQDGVATDPKKVEKIATYPTPKSVTDLRKFL 921

Query: 427  GMVNYYRRFLRNAAKLQAPL 486
            GM  YYRRF++N   +  PL
Sbjct: 922  GMTGYYRRFIKNYGIVCRPL 941



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 26/58 (44%), Positives = 33/58 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +DL   Y QI +A +DI KTA  T  G YE+  M FGL NA  TFQ  +++     LR
Sbjct: 776 LDLRSGYHQIRMATQDIPKTAFRTHLGHYEYQVMPFGLTNAPTTFQSLMNQVLAPFLR 833



 Score = 34.3 bits (75), Expect = 2.8
 Identities = 14/43 (32%), Positives = 25/43 (58%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           +   + DDIL+YS+D  +H  H+R + K L+    L+++   C
Sbjct: 835 YVLVFFDDILIYSKDWAEHKEHIRQVMKVLE-ENKLVVKLKKC 876


>UniRef50_UPI00015B47E9 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 1066

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 29/82 (35%), Positives = 53/82 (64%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + +  + + P KC F   EV +LG+ +S +G +P  ++++A+ +FPLP+T + +R F+G+
Sbjct: 296 LREASLKLQPDKCEFLKKEVIYLGHLLSKEGVKPDPKKLEAVSNFPLPKTQKNIREFLGL 355

Query: 433 VNYYRRFLRNAAKLQAPLVNAI 498
             YYRRF+ N + +  PL N +
Sbjct: 356 AGYYRRFVHNFSDIAKPLSNLL 377



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 23/50 (46%), Positives = 29/50 (58%)
 Frame = +3

Query: 9   DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           DL   + QIP+   D  KTA  +  GLYEF  M  GL N+  TFQR +D+
Sbjct: 209 DLAPGFFQIPLHEADRHKTAFCSSNGLYEFTKMPMGLSNSPATFQRCVDK 258


>UniRef50_UPI00015B5709 Cluster: PREDICTED: similar to pol
           polyprotein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to pol polyprotein - Nasonia vitripennis
          Length = 286

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 33/50 (66%), Positives = 40/50 (80%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL + + QIPVAPED+ KTA+ TPFGL+EF  M  GLRNA QTFQRF+D
Sbjct: 115 LDLKRDFHQIPVAPEDVPKTAVTTPFGLFEFLGMPLGLRNATQTFQRFMD 164



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 18/44 (40%), Positives = 35/44 (79%)
 Frame = +1

Query: 367 IQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAPLVNAI 498
           ++ +++ P P+T+  LRRF+G++NYYR  + +A++LQ+PL +A+
Sbjct: 216 VEDIQEQPPPKTIGELRRFLGVINYYRDCIPHASELQSPLTDAL 259


>UniRef50_UPI0000F1F7D8 Cluster: PREDICTED: similar to pol
           polyprotein; n=3; Danio rerio|Rep: PREDICTED: similar to
           pol polyprotein - Danio rerio
          Length = 1293

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 30/78 (38%), Positives = 49/78 (62%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + + G+ ++P KC F   EVTFLG+++   G     E++QA+ ++P P T Q L+ F+G+
Sbjct: 490 VSESGLKLHPEKCKFFRKEVTFLGHKLGGQGIGTVEEKVQAVSNWPAPTTAQQLKSFLGL 549

Query: 433 VNYYRRFLRNAAKLQAPL 486
            +YYRRF+   A +  PL
Sbjct: 550 ASYYRRFVEGFASIADPL 567



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           ++DL   Y Q+P+AP+   KTA  T  GL++F  + FGL NA  TF R +D+
Sbjct: 401 SLDLRSGYWQVPLAPDSRPKTAFCTSRGLWQFRVLCFGLCNAPATFARLMDK 452



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 19/48 (39%), Positives = 28/48 (58%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WT E ++ F A K SL +A ++A P P     L TDAS+  +GA  ++
Sbjct: 579 WTEECQDSFAALKLSLVTAPILAPPDPALPFILDTDASNVGMGAVLSQ 626


>UniRef50_Q3C0I2 Cluster: Putative uncharacterized protein; n=5; Lotus
            japonicus|Rep: Putative uncharacterized protein - Lotus
            japonicus
          Length = 1508

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 37/112 (33%), Positives = 61/112 (54%), Gaps = 1/112 (0%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F  +  +   +  +KC F  P + +LG+ ISA G    S +I+A++D+P P T++ LR F
Sbjct: 771  FAVLRKHSFYVKRSKCAFFTPVIEYLGHFISASGVSTDSTKIKAIQDWPEPVTIKQLRGF 830

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVS-HRSLGHLSSKNALMPVKI 576
            +G+  YYRRF++  + L +PL + +       S   S   L  KNAL+   +
Sbjct: 831  LGLTGYYRRFIKGYSILASPLTDLLRKDGFHWSAAASAAFLQLKNALVQAPV 882



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 23/46 (50%), Positives = 28/46 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQ 143
           +DL   Y Q+ + PED+ KTA  T  G YE+  M FGL NA  TFQ
Sbjct: 686 LDLRAGYHQLRMRPEDVEKTAFQTHSGQYEYVVMPFGLTNAPSTFQ 731


>UniRef50_A5AVS3 Cluster: Putative uncharacterized protein; n=8; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1499

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 34/102 (33%), Positives = 59/102 (57%), Gaps = 3/102 (2%)
 Frame = +1

Query: 274  INPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRF 453
            IN  KC F +P V FLG  +S+ G +   E+I+A+ D+P+P  +  +R F GM  +YRRF
Sbjct: 740  INLKKCTFMSPSVVFLGFVVSSKGVETDPEKIKAIVDWPVPTNIHEVRSFHGMATFYRRF 799

Query: 454  LRNAAKLQAPLVNAI---VATEVKVSHRSLGHLSSKNALMPV 570
            +RN + + AP++  +   +    K ++++   + SK    P+
Sbjct: 800  IRNFSSIMAPIIEGMKPGLFIWTKAANKAFEEIKSKMVNPPI 841



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 23/47 (48%), Positives = 26/47 (55%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           IDL   Y QI +   D  KT+  T  GLYE+  M FGL NA  TF R
Sbjct: 645 IDLRSGYHQICIRSGDEWKTSFKTKDGLYEWLVMPFGLTNAPSTFMR 691



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   Y DDIL+YSR    H  HL+ + + L+
Sbjct: 704 FVVVYFDDILIYSRSCEDHEEHLKQVMRTLR 734


>UniRef50_Q99315 Cluster: Transposon Ty3-G Gag-Pol polyprotein
            (Gag3-Pol3) (Transposon Ty3-1 TYA-TYB polyprotein)
            [Contains: Capsid protein (CA) (p24); Spacer peptide p3;
            Nucleocapsid protein p11 (NC); Ty3 protease (EC 3.4.23.-)
            (PR) (p16); Spacer peptide J; Reverse
            transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7)
            (EC 3.1.26.4) (RT) (RT-RH) (p55); Integrase p61 (IN);
            Integrase p58 (IN)]; n=12; Fungi/Metazoa group|Rep:
            Transposon Ty3-G Gag-Pol polyprotein (Gag3-Pol3)
            (Transposon Ty3-1 TYA-TYB polyprotein) [Contains: Capsid
            protein (CA) (p24); Spacer peptide p3; Nucleocapsid
            protein p11 (NC); Ty3 protease (EC 3.4.23.-) (PR) (p16);
            Spacer peptide J; Reverse transcriptase/ribonuclease H
            (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.4) (RT) (RT-RH)
            (p55); Integrase p61 (IN); Integrase p58 (IN)] -
            Saccharomyces cerevisiae (Baker's yeast)
          Length = 1547

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 29/80 (36%), Positives = 49/80 (61%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            + +++  +++   KC F + E  FLG  I      P   +  A++DFP P+TV+  +RF+
Sbjct: 769  ERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFL 828

Query: 427  GMVNYYRRFLRNAAKLQAPL 486
            GM+NYYRRF+ N +K+  P+
Sbjct: 829  GMINYYRRFIPNCSKIAQPI 848



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 30/64 (46%), Positives = 39/64 (60%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALRT 182
           T+DL   Y QIP+ P+D  KTA +TP G YE+  M FGL NA  TF R++ + T   LR 
Sbjct: 684 TLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMAD-TFRDLRF 742

Query: 183 LTTY 194
           +  Y
Sbjct: 743 VNVY 746



 Score = 39.9 bits (89), Expect = 0.056
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           R   F   Y+DDIL++S    +H  HL T+ +RLK  E+L++++  C
Sbjct: 738 RDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLK-NENLIVKKKKC 783


>UniRef50_UPI00015B4A3B Cluster: PREDICTED: similar to orf; n=1;
           Nasonia vitripennis|Rep: PREDICTED: similar to orf -
           Nasonia vitripennis
          Length = 807

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 31/84 (36%), Positives = 51/84 (60%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + +   G+ +N  KC F   +VT+LG  +S +G +P   +I A+KDFP P  V  +RRF+
Sbjct: 451 EVLRKAGLTLNIKKCQFLKEKVTYLGFELSKEGIRPGELKINAIKDFPAPVNVHEIRRFL 510

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G+  ++RRF+   A++  PL N +
Sbjct: 511 GLAGFFRRFVHKFAEIAQPLSNLL 534



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 26/55 (47%), Positives = 32/55 (58%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATI 167
           T+DL   Y Q+P+A E   KTAIITP    EFN + FGL N   T   F+D+  I
Sbjct: 382 TLDLFHGYLQLPIAEESKHKTAIITPDETAEFNRLIFGLTNG--TAAIFLDDILI 434


>UniRef50_UPI00015B47F9 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 681

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 31/81 (38%), Positives = 51/81 (62%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ + D G+ +   KC F  PE+T+LG+ I  +G +P   +I A+++FP P +   +R+F
Sbjct: 231 FERLSDAGLRLQIDKCQFLTPEITYLGHIIDKNGVRPDPSKISAVEEFPPPTSQTKIRQF 290

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G+  YYRRF+ N A+   PL
Sbjct: 291 LGLAGYYRRFILNFAEKAQPL 311



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 25/49 (51%), Positives = 30/49 (61%)
 Frame = +3

Query: 9   DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           DL   + QI + PEDI KTA  T +G +E+  M F L NA  TFQR ID
Sbjct: 147 DLAMGFHQIELEPEDIQKTAFNTKYGHFEYLCMPFELSNAPPTFQRLID 195


>UniRef50_UPI0000F1D578 Cluster: PREDICTED: similar to sarcoma antigen
            NY-SAR-41 (NY-SAR-41); n=1; Danio rerio|Rep: PREDICTED:
            similar to sarcoma antigen NY-SAR-41 (NY-SAR-41) - Danio
            rerio
          Length = 1044

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 31/82 (37%), Positives = 53/82 (64%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            +E  G+ IN  KC F  PE+TFLG+ ++A G      +++A+  FP P  ++ ++RF+G+
Sbjct: 839  LEAAGLTINLEKCKFFLPEITFLGHVVNAKGITADPSKVEAILSFPTPNNLKEVQRFLGL 898

Query: 433  VNYYRRFLRNAAKLQAPLVNAI 498
              +Y RF++N +K+  PL NA+
Sbjct: 899  AGWYHRFVQNFSKIAEPL-NAL 919


>UniRef50_Q01M69 Cluster: OSIGBa0114M03.4 protein; n=10; Oryza
           sativa|Rep: OSIGBa0114M03.4 protein - Oryza sativa
           (Rice)
          Length = 1448

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 30/78 (38%), Positives = 50/78 (64%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +  + + +  AKC FGA  V++LG+ ISA G      ++QA+ D+P P++V+ +R F+G+
Sbjct: 689 LRQHQLFVKRAKCAFGASSVSYLGHVISAAGVAMDPTKVQAILDWPAPRSVRAVRGFLGL 748

Query: 433 VNYYRRFLRNAAKLQAPL 486
             YYR+F+ N   + APL
Sbjct: 749 AGYYRKFVHNYGTVAAPL 766



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 25/51 (49%), Positives = 32/51 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL   Y Q+ + PED+ KTA  T  GLYEF  M FGL NA  TFQ  +++
Sbjct: 601 LDLRSGYHQVRMRPEDVHKTAFRTHDGLYEFLVMAFGLCNAPATFQALMND 651



 Score = 32.7 bits (71), Expect = 8.4
 Identities = 14/43 (32%), Positives = 22/43 (51%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           F   + DDIL+YS+    H  HLR +   L+    L +++  C
Sbjct: 660 FVLVFFDDILIYSKTWADHLRHLRAVLSELR-QHQLFVKRAKC 701


>UniRef50_A5BU14 Cluster: Putative uncharacterized protein; n=5; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1521

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 34/102 (33%), Positives = 58/102 (56%), Gaps = 3/102 (2%)
 Frame = +1

Query: 274  INPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRF 453
            IN  KC F +P V FLG  +S+ G +   E+I+A+ D+P+P  +  +R F GM  +YRRF
Sbjct: 807  INLKKCTFMSPSVVFLGFVVSSKGVETDPEKIKAIVDWPVPTNIHEVRSFHGMATFYRRF 866

Query: 454  LRNAAKLQAPLVNAI---VATEVKVSHRSLGHLSSKNALMPV 570
            +RN + + AP+   +   +    K ++++   + SK    P+
Sbjct: 867  IRNFSSIMAPITECMKPGLFIWTKAANKAFEEIKSKMVNPPI 908



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 24/51 (47%), Positives = 29/51 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y QI + P D  KT+  T  GLYE+  M FGL NA  TF R + +
Sbjct: 712 IDLRSGYHQIRIRPGDEWKTSFKTKDGLYEWLVMPFGLTNAPSTFMRIMTQ 762



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 16/43 (37%), Positives = 21/43 (48%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           F   Y DDIL+YSR    H  HL+ + + L+  E   I    C
Sbjct: 771 FVVVYFDDILIYSRSCEDHEEHLKQVMRTLR-AEKFYINLKKC 812


>UniRef50_Q8TFI2 Cluster: Pol protein; n=2; Kazachstania exigua|Rep:
           Pol protein - Saccharomyces exiguus (Yeast)
          Length = 1181

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 31/78 (39%), Positives = 52/78 (66%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F  P++ FLG+ +SA G  P  E+I A+KD+P P+T +  + FIG+  YYRRF+++
Sbjct: 423 SKCEFYVPKIQFLGHELSAKGITPDKEKILAIKDWPTPKTYKDAQSFIGLAGYYRRFIKD 482

Query: 463 AAKLQAPLVNAIVATEVK 516
            + +  PL + + A ++K
Sbjct: 483 FSYIAKPL-HQLAAQKIK 499



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 23/50 (46%), Positives = 30/50 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL+  Y Q+ +A ED  KTA  T  G Y +  M FGL NA  TFQR ++
Sbjct: 325 LDLISGYHQVAIADEDQYKTAFTTHRGQYSWRVMPFGLTNAPATFQRLMN 374



 Score = 35.9 bits (79), Expect = 0.91
 Identities = 14/42 (33%), Positives = 26/42 (61%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           C  Y+DDIL+YS++  +H+ H+ T+   L+    L  +++ C
Sbjct: 385 CVVYLDDILIYSKNEKEHSEHVSTIINVLR-KHQLYAKKSKC 425


>UniRef50_UPI0000F1FB24 Cluster: PREDICTED: similar to novel
           transposon; n=4; Danio rerio|Rep: PREDICTED: similar to
           novel transposon - Danio rerio
          Length = 1299

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 28/78 (35%), Positives = 52/78 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +++ G+ +  +KC FG  ++ +LG  +++ G  P  +++ A+K+ P+P  V+ L+ F+G+
Sbjct: 593 LQENGLRVKKSKCEFGKSQIEYLGFVLNSQGLHPSPDKVDAVKNAPVPTCVKELKAFLGL 652

Query: 433 VNYYRRFLRNAAKLQAPL 486
           VNYY RFL N + + APL
Sbjct: 653 VNYYGRFLPNQSTMAAPL 670



 Score = 37.1 bits (82), Expect = 0.39
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           IDL  AYQQ+ +  E      I T  GL+ +N + FG+ +A   FQR ++
Sbjct: 508 IDLASAYQQVLLEDESKELLTINTHRGLFVYNRLPFGVSSAPSIFQRIME 557



 Score = 34.3 bits (75), Expect = 2.8
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           P  W    +E F  CKD L++  ++ H  P+  L L  D+S+  +GA
Sbjct: 679 PWEWKQSEQEAFEKCKDLLTNEKVLIHYDPSLPLTLACDSSAYGIGA 725


>UniRef50_Q967S6 Cluster: Reverse transcriptase-like polymerase;
           n=3; Acalyptratae|Rep: Reverse transcriptase-like
           polymerase - Drosophila melanogaster (Fruit fly)
          Length = 1059

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 37/106 (34%), Positives = 61/106 (57%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ ++   +     KC F   +V FLG  +S  G +    ++QA+ DFP+P+T++ LR F
Sbjct: 374 FRTLQQANMKCQLDKCEFMKRKVEFLGFVVSDKGIETSPTKVQAISDFPIPRTLKELRSF 433

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNAL 561
           +G+  YYRRF+ N AKL  PL + +   + ++S      LSSK ++
Sbjct: 434 LGLSGYYRRFIPNYAKLAKPLSSLLRGEDGRISRT----LSSKKSV 475



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 22/51 (43%), Positives = 29/51 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL   + QI +   DI KTA     G YEF  + FGL+NA   FQR +D+
Sbjct: 289 LDLKSGFHQILLKESDIEKTAFSINNGKYEFTRLPFGLKNAPSIFQRALDD 339



 Score = 36.7 bits (81), Expect = 0.52
 Identities = 13/30 (43%), Positives = 22/30 (73%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           CF Y+DDI+++S+D   H  +L T+F+ L+
Sbjct: 349 CFIYIDDIIIFSKDDETHYQNLDTIFRTLQ 378


>UniRef50_Q84ZV5 Cluster: Polyprotein; n=2; Papilionoideae|Rep:
            Polyprotein - Glycine max (Soybean)
          Length = 1552

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 29/84 (34%), Positives = 52/84 (61%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q ++ + +    +KC FG  EV +LG+++S  G    + ++QA+ D+P P  V+ LR F+
Sbjct: 772  QTLKQHQLFARLSKCSFGDTEVDYLGHKVSGLGVSMENTKVQAVLDWPTPNNVKQLRGFL 831

Query: 427  GMVNYYRRFLRNAAKLQAPLVNAI 498
            G+  YYRRF+++ A +  PL + +
Sbjct: 832  GLTGYYRRFIKSYANIAGPLTDLL 855



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 29/58 (50%), Positives = 34/58 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +DL   Y QI V PED  KTA  T  G YE+  M FGL NA  TFQ  +++   FALR
Sbjct: 686 LDLRSGYHQILVQPEDREKTAFRTHHGHYEWLVMPFGLTNAPATFQCLMNKIFQFALR 743


>UniRef50_Q2R2N6 Cluster: Retrotransposon protein, putative,
           unclassified; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 1369

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 29/85 (34%), Positives = 52/85 (61%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ +  + + +  +KC F   ++ +LG+ IS +G    S++I  ++ +P+P +V+ LR F
Sbjct: 713 FQILHKHQLKVKKSKCSFAQQKLAYLGHIISPNGVSTDSDKIAVVQSWPVPSSVKELRSF 772

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+  YYR+F+RN   L  PL N +
Sbjct: 773 LGLAGYYRKFVRNYGILSKPLTNLL 797



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 23/58 (39%), Positives = 30/58 (51%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +DL   Y QI +  ED  KTA  T  G +EF  + FGL +A  TFQ  ++      LR
Sbjct: 628 LDLRAGYHQIIMHIEDEHKTAFQTHHGHFEFRVIPFGLTSAPATFQSVMNNILSSLLR 685



 Score = 36.3 bits (80), Expect = 0.69
 Identities = 16/39 (41%), Positives = 26/39 (66%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           +VDDIL+YSR   +H  HL+T+F+ L     L ++++ C
Sbjct: 691 FVDDILIYSRTLEEHLVHLQTVFQILH-KHQLKVKKSKC 728


>UniRef50_Q2R1M0 Cluster: Retrotransposon protein, putative,
            unclassified; n=5; Oryza sativa|Rep: Retrotransposon
            protein, putative, unclassified - Oryza sativa subsp.
            japonica (Rice)
          Length = 1347

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 27/82 (32%), Positives = 52/82 (63%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            ++ + + I  +KC F  P + +LG+ I A G     +++QA++D+P+P+ ++ LR F+G+
Sbjct: 762  LQQHQLYIKRSKCSFSQPSLEYLGHIIGAIGVATDPQKVQAIRDWPVPKNLKQLRGFLGL 821

Query: 433  VNYYRRFLRNAAKLQAPLVNAI 498
              YYR+F+RN   +  PL+  +
Sbjct: 822  AGYYRKFIRNYGVITKPLIELL 843



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 26/56 (46%), Positives = 32/56 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFA 173
           +DL   Y QI +  +D  KTA  T  G Y+F  M FGL NA  TFQ  ++  TIFA
Sbjct: 674 LDLRSGYHQIRLVEKDEFKTAFKTHQGHYKFRVMPFGLTNAPATFQGLMN--TIFA 727



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 15/43 (34%), Positives = 26/43 (60%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           F   +VDDIL+YS+   +H  HL+++   L+    L I+++ C
Sbjct: 733 FVLVFVDDILIYSKTLAEHVCHLKSVLTVLQ-QHQLYIKRSKC 774


>UniRef50_Q0DB93 Cluster: Os06g0590100 protein; n=11; Oryza
           sativa|Rep: Os06g0590100 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 1399

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 27/73 (36%), Positives = 51/73 (69%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           +V+  +KC FG  ++++LG+ +SADG    ++++  + D+P P++V+ +R F+G+  YYR
Sbjct: 740 LVLKRSKCHFGERQISYLGHVVSADGVAMDAQKVCTVADWPRPRSVRAVRGFLGLAGYYR 799

Query: 448 RFLRNAAKLQAPL 486
           +F+RN   + APL
Sbjct: 800 KFIRNYGTIAAPL 812



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 21/50 (42%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL   Y Q+ +  +D+ KTA  T  G +EF  M FGL NA  TFQ  ++
Sbjct: 647 LDLRSGYHQVRMHADDVHKTAFRTHRGHFEFLVMPFGLMNAPATFQALMN 696


>UniRef50_A5B9Z6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 798

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 31/85 (36%), Positives = 52/85 (61%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ + +  + + P K  F   E+TFLG++ISAD  +    ++QA+  +P+P  V  L+ F
Sbjct: 92  FQRLRENRLYVKPEKYEFAQEEITFLGHKISADLIRMDKGKVQAIMKWPVPTKVTELQSF 151

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
            G+ NYYRRF++  +K  +PL + +
Sbjct: 152 FGLTNYYRRFIKGYSKRVSPLTDLL 176



 Score = 39.1 bits (87), Expect = 0.097
 Identities = 15/31 (48%), Positives = 22/31 (70%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   Y+DDI+VYS+   +H  HLR +F+RL+
Sbjct: 66  FVVVYLDDIMVYSKTLTEHEKHLRLVFQRLR 96


>UniRef50_Q5KTM2 Cluster: Reverse transcriptase; n=1; Bombyx
           mori|Rep: Reverse transcriptase - Bombyx mori (Silk
           moth)
          Length = 1401

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 30/80 (37%), Positives = 49/80 (61%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +   KC F   ++ +LG  I+ DG     E+I+A+ D P+P  V  L+ F+
Sbjct: 601 QRLQDAGLTLQREKCEFFKDDINYLGYVINKDGLHKSPEKIRAMTDAPVPTNVNQLQSFL 660

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G++NYYR F+ NA+ +  PL
Sbjct: 661 GLINYYRSFVPNASAILKPL 680



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           W  E E  FNA K  L+S  ++AH   NA + L  DAS S + A  ++
Sbjct: 692 WGHEHENAFNAIKKCLASDQVLAHFNHNATIILTVDASPSGLSAILSQ 739



 Score = 33.1 bits (72), Expect = 6.4
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AY Q+ +  E    T I T  G+Y+   + FGL ++   FQR I+
Sbjct: 517 LDLSSAYNQLVLDEESQELTCINTHRGVYKHTRLCFGLASSPAIFQRAIE 566


>UniRef50_UPI00015B4A7F Cluster: PREDICTED: hypothetical protein; n=1;
            Nasonia vitripennis|Rep: PREDICTED: hypothetical protein
            - Nasonia vitripennis
          Length = 1179

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 29/84 (34%), Positives = 51/84 (60%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            + + + G+ + P KC F   +V +LG  I  DG +P   +I A++ FP+P+T + +++F+
Sbjct: 806  ERLRESGMKLEPEKCEFYCQKVVYLGFEIGIDGIRPNKSKINAMEFFPIPKTQKNIKQFL 865

Query: 427  GMVNYYRRFLRNAAKLQAPLVNAI 498
            G   YYR+F+ N AK   PL + +
Sbjct: 866  GADGYYRKFIPNFAKEAKPLTSLL 889



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL   + QIP+   D   TA  T +G Y+F  M FGLRN+  TF R +++
Sbjct: 720 LDLASGFHQIPMRECDKLYTAFSTSYGHYQFKRMPFGLRNSPSTFMRAMND 770


>UniRef50_Q0DC29 Cluster: Os06g0493000 protein; n=8; Eukaryota|Rep:
            Os06g0493000 protein - Oryza sativa subsp. japonica
            (Rice)
          Length = 1573

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 29/84 (34%), Positives = 52/84 (61%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q +  + +   P+KCVFG  +V +LG  IS+ G      ++QA++++P P ++  LR F+
Sbjct: 850  QLLRHHQLFAKPSKCVFGQDQVEYLGYIISSSGVATDPVKVQAVQNWPTPTSITELRGFL 909

Query: 427  GMVNYYRRFLRNAAKLQAPLVNAI 498
            G+  YYRRF++N   +  P+ +A+
Sbjct: 910  GLAGYYRRFIKNFGIICRPMFDAL 933



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 22/51 (43%), Positives = 29/51 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y QI +   D+ KTA  T  G +E+  M FGL NA  TFQ  +++
Sbjct: 764 IDLRSGYHQIRMHAADVHKTAFSTHLGHFEYLVMPFGLTNAPATFQALMNK 814



 Score = 34.3 bits (75), Expect = 2.8
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   + DDIL+YS+ A +HA HL  + + L+
Sbjct: 823 FVLVFFDDILIYSKSATEHAQHLSLVLQLLR 853


>UniRef50_A5BVZ5 Cluster: Putative uncharacterized protein; n=3;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1439

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 30/85 (35%), Positives = 51/85 (60%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ + +  + + P KC F   E+TFLG++ISA   +    ++ A+ ++  P  V  LR F
Sbjct: 621 FQRLRENRLYVKPEKCEFAQEEITFLGHKISAGLIRMDKGKVHAIMEWIAPSKVTELRSF 680

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+ NYYRRF++  +K  +PL + +
Sbjct: 681 LGLANYYRRFIKGYSKTVSPLTDLL 705



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 22/51 (43%), Positives = 29/51 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL   Y Q+ VA  D  KT  +T +G YEF  M FGL NA  TF   +++
Sbjct: 536 LDLRSGYWQVRVAAGDEGKTTCVTRYGSYEFLVMPFGLTNALATFCNLMND 586



 Score = 35.9 bits (79), Expect = 0.91
 Identities = 16/43 (37%), Positives = 25/43 (58%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           F   Y+DDI+VYS+   +   HLR +F+RL+    L ++   C
Sbjct: 595 FVVVYLDDIVVYSKTLTEQEKHLRLVFQRLR-ENRLYVKPEKC 636


>UniRef50_Q9LHM4 Cluster: Retroelement pol polyprotein; n=2;
            Arabidopsis thaliana|Rep: Retroelement pol polyprotein -
            Arabidopsis thaliana (Mouse-ear cress)
          Length = 1499

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 31/76 (40%), Positives = 51/76 (67%)
 Frame = +1

Query: 283  AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
            +KC F  P+V +LG+ ISA G +    +I+A+K++P P T++ LR F+G+  YYRRF+R+
Sbjct: 788  SKCAFAVPKVEYLGHFISAQGIETDPAKIKAVKEWPQPTTLKQLRGFLGLAGYYRRFVRS 847

Query: 463  AAKLQAPLVNAIVATE 510
               +  PL +A+  T+
Sbjct: 848  FGVIAGPL-HALTKTD 862



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 23/46 (50%), Positives = 28/46 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQ 143
           IDL   Y Q+ + P+DI KTA  T  G +E+  M FGL NA  TFQ
Sbjct: 690 IDLRAGYHQVRMDPDDIQKTAFKTHSGHFEYLVMPFGLTNAPATFQ 735


>UniRef50_A2Q2C7 Cluster: RNA-directed DNA polymerase (Reverse
           transcriptase); Chromo; Zinc finger, CCHC-type;
           Peptidase aspartic, active site; Polynucleotidyl
           transferase, Ribonuclease H fold; n=1; Medicago
           truncatula|Rep: RNA-directed DNA polymerase (Reverse
           transcriptase); Chromo; Zinc finger, CCHC-type;
           Peptidase aspartic, active site; Polynucleotidyl
           transferase, Ribonuclease H fold - Medicago truncatula
           (Barrel medic)
          Length = 1297

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 27/78 (34%), Positives = 51/78 (65%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++ +G+V N  KC FG   V +LG+ IS +G      ++ ++  +P+P+ V+G+R F+G+
Sbjct: 559 MQTHGLVANKKKCYFGQETVEYLGHLISKEGVAVDPSKVVSVTRWPIPKNVKGVRGFLGL 618

Query: 433 VNYYRRFLRNAAKLQAPL 486
            +YYR+F+++  K+  PL
Sbjct: 619 TDYYRKFIKDYGKIAKPL 636



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 58/231 (25%), Positives = 93/231 (40%), Gaps = 11/231 (4%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALRTL 185
            +DL   Y Q+ V  EDI KTA  T    YE+  M FGL NA  TFQ  +++     LR  
Sbjct: 471  LDLKSGYHQVRVKEEDIHKTAFRTHEDHYEYLVMPFGLMNAPSTFQSLMNDVFRLLLRKF 530

Query: 186  TTY*CIPVMLFNMLHTFVLFSSD*RLRNRY*SSKMRVWCS*GYF-SRKQXXXXXXXXXXX 362
                   V++F      +++S D +    +    +R+  + G   ++K+           
Sbjct: 531  -------VLVF--FDDILVYSQDWKTHMEHVEEVLRIMQTHGLVANKKKCYFGQETVEYL 581

Query: 363  AHSSSKRFSSTTDCTRTPSFHWDG*LLSPISAQCGQVTSTASQR----DRGH*GKGLTPI 530
             H  SK   +           W   +   +    G +  T   R    D G   K LT +
Sbjct: 582  GHLISKEGVAVDPSKVVSVTRWP--IPKNVKGVRGFLGLTDYYRKFIKDYGKIAKPLTEL 639

Query: 531  T------WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            T      W  + ++ F+  K  L+++ ++A P  N E  +  DAS   +GA
Sbjct: 640  TKKDAFMWNEKTQDAFDQLKRRLTTSPVLALPDFNKEFVIECDASGGGIGA 690


>UniRef50_UPI00015B4945 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 623

 Score = 69.3 bits (162), Expect = 8e-11
 Identities = 30/71 (42%), Positives = 47/71 (66%)
 Frame = +1

Query: 286 KCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNA 465
           KC F   EV+FLG+ IS  G  P  ++++A+K FP P+TV+ +R+F+G+  YYRRF+   
Sbjct: 504 KCNFLRTEVSFLGHLISNQGICPDPKKVEAVKKFPRPKTVKKIRQFLGLAGYYRRFIDGF 563

Query: 466 AKLQAPLVNAI 498
            ++  PL N +
Sbjct: 564 PRIAKPLSNLL 574



 Score = 39.1 bits (87), Expect = 0.097
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAI-ITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL   Y QIP+ PED  K A  +   G YE+N  + GL +   TF R I+
Sbjct: 403 LDLASGYYQIPLHPEDRHKAAFTVMNSGFYEWNVYSQGLTSMPATFMRCIN 453


>UniRef50_UPI0000F1DEA3 Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 934

 Score = 69.3 bits (162), Expect = 8e-11
 Identities = 30/89 (33%), Positives = 48/89 (53%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ   D  + +N AKC F    VT+LG ++     +P   +I  + ++P+P   + LRRF
Sbjct: 690 FQRFADASLTLNLAKCEFAKGMVTYLGKKVGQGMVKPVEAKITVILEYPIPTNKRELRRF 749

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAIVATE 510
           +GM  YYR F  N + +  PL + +  T+
Sbjct: 750 LGMCGYYRAFCPNFSAIMTPLTDLLSTTK 778



 Score = 39.9 bits (89), Expect = 0.056
 Identities = 17/49 (34%), Positives = 28/49 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +DL+K Y Q+P+       +A +T     ++  + FG+RNA  TFQR +
Sbjct: 607 LDLLKGYWQVPLTKRASEISAFVTADNFLQYTVLAFGMRNAPATFQRLM 655



 Score = 37.1 bits (82), Expect = 0.39
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           P  WTP  +  F A KD L SA ++  P  +    L  DAS++  GA
Sbjct: 779 PFIWTPSCQNAFTAAKDLLCSAPVLKAPQFDVPFKLQVDASATGAGA 825


>UniRef50_Q7XGR4 Cluster: Retrotransposon protein, putative,
           unclassified; n=3; Oryza sativa|Rep: Retrotransposon
           protein, putative, unclassified - Oryza sativa subsp.
           japonica (Rice)
          Length = 848

 Score = 69.3 bits (162), Expect = 8e-11
 Identities = 29/79 (36%), Positives = 50/79 (63%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D+ + +  +KC FG   +++LG+ IS+ G      +IQA+ D+PLP+    +R F+
Sbjct: 686 QTLQDHQLRLKRSKCEFGLSSISYLGHVISSAGVAMDRSKIQAVLDWPLPKNACAVRGFL 745

Query: 427 GMVNYYRRFLRNAAKLQAP 483
           G+  YYRRF+R++A    P
Sbjct: 746 GLAGYYRRFIRDSAPSPRP 764



 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 26/58 (44%), Positives = 35/58 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +D+   Y Q+ + PED+ KTA  T  GL+EF  M FGL NA  TFQ F+++     LR
Sbjct: 600 LDMRSGYHQVRMHPEDVHKTAFRTHQGLFEFLVMPFGLTNASATFQAFMNDVLFPFLR 657



 Score = 32.7 bits (71), Expect = 8.4
 Identities = 14/43 (32%), Positives = 25/43 (58%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           F   + DDIL+YS    +H  H+RT+ + L+    L ++++ C
Sbjct: 659 FVLVFFDDILIYSSSWSEHLRHVRTVLQTLQ-DHQLRLKRSKC 700


>UniRef50_Q5MG92 Cluster: Putative retrotransposon polyprotein; n=2;
            Ipomoea batatas|Rep: Putative retrotransposon polyprotein
            - Ipomoea batatas (Sweet potato) (Batate)
          Length = 1358

 Score = 69.3 bits (162), Expect = 8e-11
 Identities = 32/80 (40%), Positives = 51/80 (63%)
 Frame = +1

Query: 277  NPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFL 456
            N  KC FG   V FLG  +S+ G +    +IQA++D+P P+T   +R F G+ ++YRRF+
Sbjct: 846  NLEKCYFGVESVVFLGFIVSSKGIEVDETKIQAIRDWPTPKTATKVRSFHGLASFYRRFV 905

Query: 457  RNAAKLQAPLVNAIVATEVK 516
            ++ + + APL N +V  +VK
Sbjct: 906  KDFSTIAAPL-NELVKKDVK 924



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/50 (48%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           IDL + Y QI +   D  KTA  T  GLYE+  M FGL NA  TF R ++
Sbjct: 750 IDLRRGYHQIRMQKGDEWKTAFKTKNGLYEWLVMPFGLTNAPSTFMRLMN 799



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 17/43 (39%), Positives = 23/43 (53%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           F   Y DDIL+YS+D  +H  HL+ +F  L+  E L      C
Sbjct: 809 FVVVYFDDILIYSKDPQKHIIHLKEVFLVLR-REQLYANLEKC 850


>UniRef50_Q53NJ3 Cluster: Retrotransposon protein, putative,
            unclassified; n=2; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 1513

 Score = 69.3 bits (162), Expect = 8e-11
 Identities = 29/80 (36%), Positives = 48/80 (60%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q ++   +VI P KC FG   V++LG+ IS +G      +++ +  +P+P+ V  LR+F+
Sbjct: 817  QVLKANNLVIKPKKCAFGLSSVSYLGHIISQNGVATDPGKVEKIVSWPIPKNVTDLRKFL 876

Query: 427  GMVNYYRRFLRNAAKLQAPL 486
            GM  YYRRF++    +  PL
Sbjct: 877  GMTGYYRRFIQGYVLICRPL 896



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL+  Y QI ++  DI KTA  T  G YE+  M FGL NA  TFQ  +++
Sbjct: 731 LDLMSGYHQIRMSRPDIPKTAFRTHLGHYEYQVMPFGLTNAPATFQSLMNQ 781



 Score = 37.1 bits (82), Expect = 0.39
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           F   + DDIL+YS+D  +H  H+R + + LK   +L+I+   C
Sbjct: 790 FVLVFFDDILIYSKDREEHKEHIRLVLQVLK-ANNLVIKPKKC 831


>UniRef50_Q2QUR6 Cluster: Retrotransposon protein, putative,
           Ty3-gypsy subclass; n=2; Poaceae|Rep: Retrotransposon
           protein, putative, Ty3-gypsy subclass - Oryza sativa
           subsp. japonica (Rice)
          Length = 1202

 Score = 69.3 bits (162), Expect = 8e-11
 Identities = 29/81 (35%), Positives = 49/81 (60%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F A+ D  +  N   C+F    V+FLG  ++  G +    +I+A+K +P+PQT+  LR F
Sbjct: 741 FNALHDARLFANLENCIFCTERVSFLGYVVTPQGIEVDESKIEAIKSWPVPQTITQLRSF 800

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G+  +YRRF+++ +   APL
Sbjct: 801 LGLAGFYRRFVKDFSIFAAPL 821



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/51 (50%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y QI +   D  KTA  T FGLYE+  M FGL NA  TF R ++E
Sbjct: 656 IDLRSGYHQIRMKLGDEWKTAFKTKFGLYEWLVMPFGLTNAPSTFMRLMNE 706



 Score = 33.9 bits (74), Expect = 3.7
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRL 256
           F   Y DDIL+YS+   +H  HLR +F  L
Sbjct: 715 FVVVYFDDILIYSKSFDEHMDHLRAVFNAL 744


>UniRef50_Q0DZB8 Cluster: Os02g0633000 protein; n=3; Oryza sativa|Rep:
            Os02g0633000 protein - Oryza sativa subsp. japonica
            (Rice)
          Length = 1817

 Score = 69.3 bits (162), Expect = 8e-11
 Identities = 30/83 (36%), Positives = 50/83 (60%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F  +    + +  +KCVF    +T+LG+ ISA+G    ++ IQA+  +P+P  V+ +R F
Sbjct: 1213 FDILSANQLQVKRSKCVFARSSLTYLGHVISAEGVSTDAKNIQAVLQWPVPSNVKEVRGF 1272

Query: 424  IGMVNYYRRFLRNAAKLQAPLVN 492
            +G+  YYR+F+R+   L  PL N
Sbjct: 1273 LGLAGYYRKFVRHFGILSRPLTN 1295



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 26/56 (46%), Positives = 33/56 (58%)
 Frame = +3

Query: 3    TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIF 170
            ++DL   Y QI + PED  KTA  T  G YEF  M++GL  A  TFQ  ++  TIF
Sbjct: 1127 SLDLRAGYHQIRMKPEDEHKTAFKTHNGHYEFRVMSYGLTGAPATFQGIMN--TIF 1180



 Score = 33.9 bits (74), Expect = 3.7
 Identities = 18/44 (40%), Positives = 27/44 (61%)
 Frame = +3

Query: 534  WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            WT E +  F+A K +L+SA ++A P  +    + TDAS+  VGA
Sbjct: 1305 WTAETQASFDALKTALTSAPVLALPDFSKTFEIETDASAVGVGA 1348


>UniRef50_UPI00015B4B9B Cluster: PREDICTED: hypothetical protein,
            partial; n=1; Nasonia vitripennis|Rep: PREDICTED:
            hypothetical protein, partial - Nasonia vitripennis
          Length = 2637

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 29/84 (34%), Positives = 51/84 (60%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            + +E   + +N   C F   EV +LG+ IS DG +P   +++A+ + P P+ V+ +R+ +
Sbjct: 944  ERLEQRNLKLNLKICEFLKEEVCYLGHIISKDGLKPDPRKLEAVANIPRPKNVKNIRQML 1003

Query: 427  GMVNYYRRFLRNAAKLQAPLVNAI 498
            G+  YYRRF++N AK+  PL   +
Sbjct: 1004 GLFGYYRRFIQNFAKIAKPLTRLL 1027



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/51 (58%), Positives = 35/51 (68%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            +DL   + QI + P D  KTA  TPFG YEF  MTFGLRNA  TFQRF+D+
Sbjct: 858  VDLASGFHQILIDPADAHKTAFSTPFGHYEFVRMTFGLRNAPATFQRFMDD 908


>UniRef50_UPI00015B47C1 Cluster: PREDICTED: similar to gag-pol
           polyprotein; n=2; Nasonia vitripennis|Rep: PREDICTED:
           similar to gag-pol polyprotein - Nasonia vitripennis
          Length = 1161

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 30/50 (60%), Positives = 38/50 (76%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL KA+ Q+P+APED  KTAI TPFGL+EF   + GLRNA Q+ QR +D
Sbjct: 319 VDLKKAFYQVPIAPEDAHKTAITTPFGLFEFTRSSMGLRNAAQSLQRAMD 368



 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 26/62 (41%), Positives = 34/62 (54%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  +    I IN  KCV     V +LG RIS DG  PP  +++A++ FP P     LRRF
Sbjct: 402 FATLRRARIKINQDKCVLARESVNYLGYRISKDGCSPPPGKVEAIQAFPQPADTSQLRRF 461

Query: 424 IG 429
           +G
Sbjct: 462 LG 463



 Score = 36.7 bits (81), Expect = 0.52
 Identities = 20/49 (40%), Positives = 27/49 (55%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLV 301
           R   F  AY+DDI+V S    QH  HLR LF  L+    + I Q+ C++
Sbjct: 372 RDLPFARAYLDDIVVASWGREQHLEHLRVLFATLR-RARIKINQDKCVL 419



 Score = 36.3 bits (80), Expect = 0.69
 Identities = 17/52 (32%), Positives = 25/52 (48%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           +P+ WT E  + F   K +L+ A         A L L+TDAS   +GA   +
Sbjct: 468 SPLAWTKEARDAFEKTKRALADAVTTTFLRREAPLRLYTDASDVAIGAALEQ 519


>UniRef50_UPI0000E49FEF Cluster: PREDICTED: similar to LReO_3; n=2;
            Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
            LReO_3 - Strongylocentrotus purpuratus
          Length = 1320

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 30/85 (35%), Positives = 49/85 (57%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F  +   G+V N AKC F    VT+LG+ +      P   ++QA+ +FP P + + + RF
Sbjct: 1001 FDRLTKAGLVANLAKCEFAKATVTYLGHEVGRGHVVPRQAKVQAIVEFPAPSSKKEVMRF 1060

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAI 498
            +GM  +YR+F+ N + L APL + +
Sbjct: 1061 LGMCGFYRKFVPNFSDLVAPLTDLL 1085



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 24/63 (38%), Positives = 37/63 (58%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALRTL 185
            +DL+K Y Q+P++      +A +TP GL++   M FG+RNA  TFQR + +  I  L  +
Sbjct: 918  LDLMKGYWQVPLSRRAKEVSAFVTPQGLFQCRVMPFGMRNAPATFQRLMTD-VIAGLDNV 976

Query: 186  TTY 194
              Y
Sbjct: 977  VVY 979



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 16/31 (51%), Positives = 19/31 (61%)
 Frame = +2

Query: 164  DFCFAYVDDILVYSRDALQHAAHLRTLFKRL 256
            D    Y+DDILV+S     H A+LR LF RL
Sbjct: 974  DNVVVYIDDILVFSDTWSDHLAYLRDLFDRL 1004


>UniRef50_UPI0000E46771 Cluster: PREDICTED: similar to
           retrotransposon protein, putative, Ty3-gypsy subclass;
           n=3; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to retrotransposon protein, putative, Ty3-gypsy
           subclass - Strongylocentrotus purpuratus
          Length = 703

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 29/78 (37%), Positives = 48/78 (61%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + D G+  N  KC FG  E+ F+G+R++++G  P   +++A+ +   PQT   +R F+G+
Sbjct: 41  LRDAGLTANAEKCKFGVSELDFMGHRLTSEGLNPGLAKVKAIAEAREPQTATEMRSFLGL 100

Query: 433 VNYYRRFLRNAAKLQAPL 486
           VNY  +F+ N A L  PL
Sbjct: 101 VNYCAKFIPNFATLADPL 118


>UniRef50_Q7XW39 Cluster: OSJNBb0062H02.17 protein; n=5; Oryza sativa
            (japonica cultivar-group)|Rep: OSJNBb0062H02.17 protein -
            Oryza sativa subsp. japonica (Rice)
          Length = 1629

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 30/85 (35%), Positives = 49/85 (57%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            FQ +  + + +   KC F   E+ +LG+ I  +G     E+IQ ++ +P P +V+ LR F
Sbjct: 853  FQILLKHQLKVKRTKCSFAQQELAYLGHIIQPNGVSTDPEKIQVIQHWPAPTSVKELRSF 912

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAI 498
            +G+  YYR+F+RN   L  PL N +
Sbjct: 913  LGLSGYYRKFVRNYGILSKPLTNLL 937



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 23/58 (39%), Positives = 31/58 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +DL   Y QI + P+D  KTA  T  G +EF  + FGL +A  TFQ  ++      LR
Sbjct: 768 LDLRSGYHQIRMHPDDEHKTAFQTHHGHFEFRVLPFGLTSAPATFQGVMNSVLATLLR 825



 Score = 36.7 bits (81), Expect = 0.52
 Identities = 15/39 (38%), Positives = 26/39 (66%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           +VDDIL+YS+   +H  HL+T+F+ L +   L +++  C
Sbjct: 831 FVDDILIYSKSLEEHVQHLKTVFQIL-LKHQLKVKRTKC 868



 Score = 33.9 bits (74), Expect = 3.7
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = +3

Query: 534  WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            WT E E+ F A K +L +A ++A P       + TDAS   +GA
Sbjct: 945  WTAETEDAFQALKQALITALVLAMPDFQTPFVVETDASDKGIGA 988


>UniRef50_UPI0000F1F902 Cluster: PREDICTED: similar to pol
           polyprotein; n=1; Danio rerio|Rep: PREDICTED: similar to
           pol polyprotein - Danio rerio
          Length = 976

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 30/81 (37%), Positives = 48/81 (59%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  +  +G+ +NP KC     EV +LG  +S++G    SE+I  ++D+  P T + + RF
Sbjct: 194 FNHLRKHGLKLNPTKCCLLRKEVQYLGYVVSSEGIWTDSEKISKVRDWKRPSTAKEVLRF 253

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G   YYRRF++  + L APL
Sbjct: 254 LGFSGYYRRFIKGYSALAAPL 274



 Score = 56.4 bits (130), Expect = 6e-07
 Identities = 27/49 (55%), Positives = 31/49 (63%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +DL   Y Q+ VA  D  KTA  TP GLYE N M FGL+NA  TFQR +
Sbjct: 109 LDLTSGYWQVEVAEHDKHKTAFSTPMGLYEANKMPFGLQNAPSTFQRLM 157


>UniRef50_Q7XPW2 Cluster: OSJNBa0032F06.19 protein; n=4;
            Eukaryota|Rep: OSJNBa0032F06.19 protein - Oryza sativa
            subsp. japonica (Rice)
          Length = 1575

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +1

Query: 283  AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
            +KC F    + +LG+ ISA G     E+I A+KD+P P +V+ LR F+G+  YYR+F+RN
Sbjct: 884  SKCSFAQQSLAYLGHIISAQGVATDEEKIIAVKDWPTPLSVKDLRSFLGLTGYYRKFVRN 943

Query: 463  AAKLQAPLVNAI 498
               +  PL N +
Sbjct: 944  YGVICKPLTNLL 955



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/58 (41%), Positives = 32/58 (55%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +DL   Y QI +AP+D  KTA  T  G +EF  + FGL +A  TFQ  ++      LR
Sbjct: 786 LDLRSGYHQIRMAPQDEHKTAFKTHNGHFEFRVLPFGLTSAPATFQGVMNSVLAAQLR 843


>UniRef50_Q259G0 Cluster: H0124B04.16 protein; n=1; Oryza sativa|Rep:
            H0124B04.16 protein - Oryza sativa (Rice)
          Length = 1265

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +1

Query: 283  AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
            +KC F    + +LG+ ISA G     E+I A+KD+P P +V+ LR F+G+  YYR+F+RN
Sbjct: 833  SKCSFAQQSLAYLGHIISAQGVATDEEKIIAVKDWPTPLSVKDLRSFLGLTGYYRKFVRN 892

Query: 463  AAKLQAPLVNAI 498
               +  PL N +
Sbjct: 893  YGVICKPLTNLL 904



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/58 (41%), Positives = 32/58 (55%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +DL   Y QI +AP+D  KTA  T  G +EF  + FGL +A  TFQ  ++      LR
Sbjct: 735 LDLRSGYHQIRMAPQDEHKTAFKTHNGHFEFRVLPFGLTSAPATFQGVMNSVLAAQLR 792


>UniRef50_Q6B961 Cluster: Polyprotein; n=4; Candida glabrata|Rep:
            Polyprotein - Candida glabrata (Yeast) (Torulopsis
            glabrata)
          Length = 1504

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 36/102 (35%), Positives = 60/102 (58%), Gaps = 3/102 (2%)
 Frame = +1

Query: 283  AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
            +KC F   +V FLG+ I+A+G     E+I A+K +P+ +  +  +RF+G+ NYYRRF++N
Sbjct: 704  SKCHFMLTQVQFLGHVINANGISTDPEKINAIKQWPILRNYKDAQRFLGLANYYRRFIKN 763

Query: 463  AAKLQAPLVNAIVATEVK-VSHRSLGHLSSKNALM--PVKIA 579
             +K+ +PL         K  +      +S K+AL+  P+ IA
Sbjct: 764  FSKMASPLYEFAAKKNTKWTTECHNAFISLKDALISAPILIA 805



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 23/50 (46%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL+  Y Q+ V   D  KT+ IT  G Y++N M FGL NA  TFQR ++
Sbjct: 606 LDLISGYHQVSVNEPDRYKTSFITHEGQYQWNVMPFGLTNAPATFQRLMN 655



 Score = 36.7 bits (81), Expect = 0.52
 Identities = 16/47 (34%), Positives = 28/47 (59%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLL 307
           FC  Y+DDIL+YS+   +H  H+  +  +L+   SL  +++ C  +L
Sbjct: 665 FCVVYLDDILIYSKTREEHLHHISQVLDKLR-KHSLYPKKSKCHFML 710


>UniRef50_P92523 Cluster: Uncharacterized mitochondrial protein
           AtMg00860; n=60; Spermatophyta|Rep: Uncharacterized
           mitochondrial protein AtMg00860 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 158

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 31/92 (33%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNR--ISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           Q  E +    N  KC FG P++ +LG+R  IS +G      +++A+  +P P+    LR 
Sbjct: 9   QIWEQHQFYANRKKCAFGQPQIAYLGHRHIISGEGVSADPAKLEAMVGWPEPKNTTELRG 68

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAIVATEVK 516
           F+G+  YYRRF++N  K+  PL   +    +K
Sbjct: 69  FLGLTGYYRRFVKNYGKIVRPLTELLKKNSLK 100


>UniRef50_UPI00015B487E Cluster: PREDICTED: similar to protease,
            reverse transcriptase, ribonuclease H, integrase; n=5;
            Nasonia vitripennis|Rep: PREDICTED: similar to protease,
            reverse transcriptase, ribonuclease H, integrase -
            Nasonia vitripennis
          Length = 2126

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 28/87 (32%), Positives = 51/87 (58%)
 Frame = +1

Query: 238  YSFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLR 417
            Y  + +   G+ INP KC F   E+ +LG  +  DG +    ++  + ++P P+ ++ LR
Sbjct: 1465 YVLKKLVAAGLTINPKKCAFCVREIKYLGFILDRDGLRTDPAKVAPVLNYPAPRNIRELR 1524

Query: 418  RFIGMVNYYRRFLRNAAKLQAPLVNAI 498
            RF+GMV +Y RF+   ++++ PLV  +
Sbjct: 1525 RFLGMVGWYSRFMPEHSEMKIPLVKLL 1551



 Score = 39.9 bits (89), Expect = 0.056
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITP-FGLYEFNYMTFGLRNAGQTFQRFID 155
            IDL +AY QI +       TA   P +GL++   M FGL NA  T QR +D
Sbjct: 1381 IDLRQAYYQIKMEESSKKYTAFAVPGYGLWQLTRMPFGLINAPMTLQRLVD 1431


>UniRef50_UPI0000F21643 Cluster: PREDICTED: similar to pol
           polyprotein; n=24; Danio rerio|Rep: PREDICTED: similar
           to pol polyprotein - Danio rerio
          Length = 1836

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 30/80 (37%), Positives = 51/80 (63%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q + +  + +   KCVF A  V+FLG  ISA   +    +++A+ ++P P + + L+RF+
Sbjct: 649 QRLLENQLFVKAEKCVFHAKSVSFLGFVISAGEIKADPSKVRAVAEWPTPDSRKALQRFL 708

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G  N+YRRF+RN +++ APL
Sbjct: 709 GFANFYRRFIRNFSQIAAPL 728



 Score = 41.5 bits (93), Expect = 0.018
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL  AY  I +   D  KTA  TP G +E+  + FGL NA   FQ  +++
Sbjct: 563 LDLRNAYHLIRIREGDEWKTAFNTPTGHFEYRVLPFGLTNAPAVFQALVND 613



 Score = 35.9 bits (79), Expect = 0.91
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACL 298
           F F Y+DDIL++S     H  H+R + +RL +   L ++   C+
Sbjct: 622 FVFVYLDDILIFSPSMQVHTQHVRQVLQRL-LENQLFVKAEKCV 664


>UniRef50_Q9SQW9 Cluster: Putative retroelement pol polyprotein; n=1;
            Arabidopsis thaliana|Rep: Putative retroelement pol
            polyprotein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 1661

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 28/70 (40%), Positives = 45/70 (64%)
 Frame = +1

Query: 277  NPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFL 456
            N  KC FG+  +++LG+ IS  G     E+++A+  +PLP++V  LR F+G   YYRRF+
Sbjct: 900  NFKKCTFGSTRISYLGHIISEQGVATDPEKVEAMLQWPLPKSVTELRGFLGFTGYYRRFV 959

Query: 457  RNAAKLQAPL 486
            +N  ++  PL
Sbjct: 960  KNYGQIARPL 969



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 23/51 (45%), Positives = 29/51 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL   Y QI +   D+ KTA  T  G YEF  M FGL NA  TFQ  +++
Sbjct: 804 LDLKSGYFQIRMKLSDVEKTAFKTHEGHYEFLVMPFGLTNAPSTFQSVMND 854


>UniRef50_Q7XPJ7 Cluster: OSJNBa0087O24.13 protein; n=5; Oryza
           sativa|Rep: OSJNBa0087O24.13 protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 1311

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 30/87 (34%), Positives = 52/87 (59%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +  + +   P+KCVFG  +V +LG  IS  G      ++QA+K++P+P++V  L  F+
Sbjct: 587 QLLRQHHLSAKPSKCVFGQSQVEYLGYIISNAGVAIDPTKVQAVKNWPVPKSVTDLSGFL 646

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAIVAT 507
           G+  YYR+F+++   +  PL  A+  T
Sbjct: 647 GLAGYYRKFIKDFGLICKPLFTALKKT 673



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 21/46 (45%), Positives = 27/46 (58%)
 Frame = +3

Query: 18  KAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           + Y QI + P DI KTA  T  G +E+  M FGL NA  TFQ  ++
Sbjct: 505 RGYHQIRMHPADIYKTAFSTHMGHFEYLVMPFGLTNAPATFQALMN 550


>UniRef50_Q5NRP7 Cluster: Putative gag-pol polyprotein, identical;
            n=2; Solanum demissum|Rep: Putative gag-pol polyprotein,
            identical - Solanum demissum (Wild potato)
          Length = 1588

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 31/90 (34%), Positives = 53/90 (58%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F+ + +  +  N  KC F    V FLG  +S+ G +   E+I+A+K++P P +V  +R F
Sbjct: 875  FEVLRNQRLFANLKKCTFCVDRVVFLGFVVSSMGVEVDDEKIKAIKEWPKPNSVTEVRSF 934

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAIVATEV 513
             G+ ++YRRF+R+ + + APL   I   +V
Sbjct: 935  HGLASFYRRFVRDFSTIAAPLTEVIKKDKV 964



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 25/50 (50%), Positives = 30/50 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           IDL   Y QI + P D  KTA  T +GLYE+  M FGL NA  TF R ++
Sbjct: 790 IDLKSGYHQIRLNPGDEWKTAFKTKYGLYEWLVMPFGLTNAPSTFMRLMN 839



 Score = 32.7 bits (71), Expect = 8.4
 Identities = 17/45 (37%), Positives = 23/45 (51%)
 Frame = +3

Query: 531  TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            TW  E ++ FN  KD L SA L+  P  +    +  DAS   +GA
Sbjct: 966  TWGKEQDDAFNLLKDKLCSAPLLQLPDFSKSFEVECDASGKGIGA 1010


>UniRef50_A5AR78 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 773

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 28/77 (36%), Positives = 48/77 (62%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           +F  + +  + + P KC F   E+TFLG++ISA   +    ++QA+ ++P+P  V  LR 
Sbjct: 506 AFVRLRENRLYVKPEKCEFAQEEITFLGHKISAGLIRMDKGKVQAIMEWPVPSKVTELRS 565

Query: 421 FIGMVNYYRRFLRNAAK 471
           F+ + NYYRRF++  +K
Sbjct: 566 FLSLANYYRRFIKGYSK 582



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 21/51 (41%), Positives = 29/51 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL   Y Q+ +A  D  KT  +T +G YEF  M FGL NA  TF   +++
Sbjct: 448 VDLRSGYWQVQIAEGDEGKTTCVTRYGSYEFLVMPFGLTNAPATFCNLMND 498


>UniRef50_Q4QQF4 Cluster: Gag-pol polyprotein; n=8; Bilateria|Rep:
           Gag-pol polyprotein - Schistosoma mansoni (Blood fluke)
          Length = 1357

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 36/88 (40%), Positives = 51/88 (57%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           I +YG  +   KC F   +V++LG  I  DG +P  E  QA+K  P P  V  LR F+G+
Sbjct: 661 IAEYGFRLRAEKCNFCMKKVSYLGFIIDQDGRRPBPENTQAVKTMPRPTDVPTLRSFLGL 720

Query: 433 VNYYRRFLRNAAKLQAPLVNAIVATEVK 516
           V++Y  F+ N   L+APL N ++A  VK
Sbjct: 721 VSHYGAFIPNLHHLRAPL-NNLLAKNVK 747



 Score = 41.1 bits (92), Expect = 0.024
 Identities = 21/50 (42%), Positives = 30/50 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AY QIPVA E      I T  GL+ +N + FG++ A   FQ+ +D
Sbjct: 575 LDLSEAYLQIPVADECKNLLTINTHKGLFRYNRLPFGVKTAPSIFQQVMD 624


>UniRef50_P10394 Cluster: Retrovirus-related Pol polyprotein from
           transposon 412 [Includes: Protease (EC 3.4.23.-);
           Reverse transcriptase (EC 2.7.7.49); Endonuclease]; n=9;
           Drosophila melanogaster|Rep: Retrovirus-related Pol
           polyprotein from transposon 412 [Includes: Protease (EC
           3.4.23.-); Reverse transcriptase (EC 2.7.7.49);
           Endonuclease] - Drosophila melanogaster (Fruit fly)
          Length = 1237

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 27/75 (36%), Positives = 44/75 (58%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F    +Y + ++P KC F   EVTFLG++ +  G  P  ++   ++++P+P      RRF
Sbjct: 494 FGKCREYNLKLHPEKCSFFMHEVTFLGHKCTDKGILPDDKKYDVIQNYPVPHDADSARRF 553

Query: 424 IGMVNYYRRFLRNAA 468
           +   NYYRRF++N A
Sbjct: 554 VAFCNYYRRFIKNFA 568


>UniRef50_UPI00015B484B Cluster: PREDICTED: similar to protease,
           reverse transcriptase, ribonuclease H, integrase; n=1;
           Nasonia vitripennis|Rep: PREDICTED: similar to protease,
           reverse transcriptase, ribonuclease H, integrase -
           Nasonia vitripennis
          Length = 1079

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 32/78 (41%), Positives = 49/78 (62%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           I++ G+ +N  K VF   EV +LG  ++ DG +P  E+I  + +FP P+ ++ LRRF GM
Sbjct: 586 IKEAGLTVNREKRVFCKEEVKYLGVLVNRDGFRPDPEKIAPIVNFPQPKNLKQLRRFHGM 645

Query: 433 VNYYRRFLRNAAKLQAPL 486
            ++YR+FL   A L  PL
Sbjct: 646 ASWYRQFLEGYAALAEPL 663



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +3

Query: 12  LVKAYQQIPVAPEDICKTAIITP-FGLYEFNYMTFGLRNAGQTFQRFIDE 158
           L  AY QIPV+ E    TA   P  GL++F  + FGL  AG TFQR +D+
Sbjct: 499 LSSAYHQIPVSEESKQYTAFTVPGMGLFQFKRLPFGLSEAGATFQRLMDK 548


>UniRef50_UPI00015B43B8 Cluster: PREDICTED: similar to protease,
           reverse transcriptase, ribonuclease H, integrase; n=1;
           Nasonia vitripennis|Rep: PREDICTED: similar to protease,
           reverse transcriptase, ribonuclease H, integrase -
           Nasonia vitripennis
          Length = 702

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 28/74 (37%), Positives = 48/74 (64%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+V+N  KC F   ++ +LG  +  +G +P  ER++ +K+FP P+ V+ LRRF+GM+ +Y
Sbjct: 400 GLVVNEEKCEFCFSQIRWLGFLLDNEGLRPDPERVEPVKNFPAPKNVKQLRRFLGMLGWY 459

Query: 445 RRFLRNAAKLQAPL 486
             F+    +L+ PL
Sbjct: 460 SHFIDYEFELKVPL 473



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 25/51 (49%), Positives = 32/51 (62%), Gaps = 1/51 (1%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITP-FGLYEFNYMTFGLRNAGQTFQRFID 155
           IDL ++Y QIP++PE    TA   P  GL++F  M FGL NA +  QR ID
Sbjct: 307 IDLKQSYYQIPLSPESRKYTAFFVPGSGLWQFKRMLFGLCNAPRIQQRLID 357


>UniRef50_UPI0000F211A4 Cluster: PREDICTED: similar to LReO_3; n=2;
            Danio rerio|Rep: PREDICTED: similar to LReO_3 - Danio
            rerio
          Length = 1366

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 30/85 (35%), Positives = 48/85 (56%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F+ +    + +N  KC F    VT+LG R+     +P   +++A+  FP+P   + LRRF
Sbjct: 1126 FKQLTRASLTLNLKKCEFAKAVVTYLGKRVGQVRVKPVEGKVEAILKFPIPCNKRELRRF 1185

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAI 498
            +GMV YYR F +N A +  PL + +
Sbjct: 1186 LGMVGYYRSFCQNFATIVTPLTDLL 1210



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            +DL+K Y Q+P++      +A +TP  L +++ M FG+RNA  TFQR + +
Sbjct: 1043 LDLLKGYWQVPLSHCASEISAFVTPDNLLQYSVMAFGMRNAPATFQRLMQK 1093



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 20/44 (45%), Positives = 26/44 (59%)
 Frame = +3

Query: 534  WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            W+PE +  F A KD LSSA +++ P  +    L  DASSS  GA
Sbjct: 1218 WSPECDSTFKATKDLLSSAPVLSAPCFDIPFLLQVDASSSGAGA 1261


>UniRef50_UPI0000F1ED4F Cluster: PREDICTED: similar to pol
           polyprotein; n=21; Danio rerio|Rep: PREDICTED: similar
           to pol polyprotein - Danio rerio
          Length = 1473

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 34/103 (33%), Positives = 54/103 (52%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +  + + +   KC F  P V FLG  I   G +    ++ A+  +P P TV+ L+RF+
Sbjct: 657 QTLRKHQLYLKAEKCSFHLPSVQFLGYVIDKRGVRMDEGKVTAVVSWPEPTTVKELQRFL 716

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKN 555
           G  N+YRRF+ N + + APL N +     K+S  S    + +N
Sbjct: 717 GFANFYRRFIHNYSLVTAPLTNLLKNKPKKLSWPSEAAAAFRN 759



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 22/51 (43%), Positives = 28/51 (54%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL  AY  + +   D  KT  +TP G YE+  M +GL NA   FQ FI E
Sbjct: 571 LDLRSAYNLVRIRRGDEWKTGFVTPTGHYEYRVMPYGLVNAPSVFQNFIHE 621



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 14/43 (32%), Positives = 25/43 (58%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           F   Y+DDIL+YSR+ ++H  H+  + + L+    L ++   C
Sbjct: 630 FVIVYIDDILIYSRNEVEHRHHVEKVLQTLR-KHQLYLKAEKC 671



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 15/50 (30%), Positives = 27/50 (54%)
 Frame = +3

Query: 528 ITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           ++W  E    F   K++ + A L+ HP P+    +  DAS++ VGA  ++
Sbjct: 747 LSWPSEAAAAFRNLKEAFTRAPLLTHPDPDLPFIVEVDASTTGVGAILSQ 796


>UniRef50_Q75J00 Cluster: Retrotransposon protein, putative,
           Ty3-gypsy sub-class; n=5; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           Ty3-gypsy sub-class - Oryza sativa subsp. japonica
           (Rice)
          Length = 1223

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 28/81 (34%), Positives = 49/81 (60%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F A+ D  +  N  KC+F    V+FLG  ++  G +    +I+A+K +P+PQT+  +R F
Sbjct: 675 FNALRDARLFANLEKCIFCTERVSFLGYIVTPQGIEVDEMKIKAIKSWPVPQTITQVRSF 734

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G+  +Y RF+++ +   APL
Sbjct: 735 LGLAGFYHRFVKDFSTFAAPL 755


>UniRef50_UPI00015B487C Cluster: PREDICTED: similar to protease,
           reverse transcriptase, ribonuclease H, integrase; n=7;
           Nasonia vitripennis|Rep: PREDICTED: similar to protease,
           reverse transcriptase, ribonuclease H, integrase -
           Nasonia vitripennis
          Length = 961

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 32/78 (41%), Positives = 49/78 (62%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           I++ G+  N  K VF   EV +LG  ++ DG +P  E+I  + +FP P+ ++ LRRF GM
Sbjct: 317 IKEAGLTANREKSVFCKEEVKYLGVLVNRDGFRPDPEKIAPIVNFPQPKNLKQLRRFHGM 376

Query: 433 VNYYRRFLRNAAKLQAPL 486
            ++YR+FL + A L  PL
Sbjct: 377 ASWYRQFLEDYAALAEPL 394



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/53 (49%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITP-FGLYEFNYMTFGLRNAGQTFQRFIDE 158
           TIDL  AY QIP++ E    TA   P   L +F  + FGL  AG TFQR ID+
Sbjct: 227 TIDLSSAYHQIPLSEESKQYTAFTVPGMELIQFKRLPFGLSEAGATFQRLIDK 279


>UniRef50_UPI00015B4584 Cluster: PREDICTED: similar to
           retrotransposon protein, putative, Ty3-gypsy subclass;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           retrotransposon protein, putative, Ty3-gypsy subclass -
           Nasonia vitripennis
          Length = 537

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 26/71 (36%), Positives = 48/71 (67%)
 Frame = +1

Query: 286 KCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNA 465
           +C F   EV +L + +S +G +P  ++++A+++FPLP+T + +R F+G+  YYRRF+ N 
Sbjct: 248 QCCFLKKEVIYLEHLLSKEGVKPAPKKLEAVRNFPLPKTQKNIREFLGLAGYYRRFVHNF 307

Query: 466 AKLQAPLVNAI 498
           + +  PL N +
Sbjct: 308 SGIAKPLSNLL 318



 Score = 39.1 bits (87), Expect = 0.097
 Identities = 20/45 (44%), Positives = 26/45 (57%)
 Frame = +3

Query: 9   DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQ 143
           DL + + QIP+   +  KTA  +  GLYEF  M  GL N+  TFQ
Sbjct: 204 DLAQGFFQIPLHEAERHKTAFCSSNGLYEFTKMPMGLSNSLATFQ 248


>UniRef50_UPI00015B455D Cluster: PREDICTED: similar to polyprotein;
           n=5; Nasonia vitripennis|Rep: PREDICTED: similar to
           polyprotein - Nasonia vitripennis
          Length = 1427

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 30/78 (38%), Positives = 43/78 (55%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + ++G+ +N AKC F AP V  LG++I A G       I+A++D P P T + L  FIG 
Sbjct: 699 LREHGLRLNRAKCTFAAPAVEMLGHKIDAQGVHKSDMHIEAIRDAPKPSTPEDLELFIGK 758

Query: 433 VNYYRRFLRNAAKLQAPL 486
             YY  F+ + A    PL
Sbjct: 759 ATYYNAFIPDLATKARPL 776


>UniRef50_UPI00015B455C Cluster: PREDICTED: hypothetical protein; n=1;
            Nasonia vitripennis|Rep: PREDICTED: hypothetical protein
            - Nasonia vitripennis
          Length = 3473

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 31/83 (37%), Positives = 52/83 (62%)
 Frame = +1

Query: 268  IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
            +V+ P K  F   EV FLG+ IS+ G +P  E+++A+   P P+T + +R  +GM  YYR
Sbjct: 950  LVLQPDKIEFFRREVGFLGHIISSRGIEPNPEKVEAITKLPTPKTAKNVRTLLGMFGYYR 1009

Query: 448  RFLRNAAKLQAPLVNAIVATEVK 516
            +++++ AK+  PL N ++   VK
Sbjct: 1010 KYIKDFAKIAKPL-NDLLKKNVK 1031



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 25/51 (49%), Positives = 33/51 (64%)
 Frame = +3

Query: 9    DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
            DL   +QQIP+APED  KTA  T    YE+  +  GL+NA  TFQR +++A
Sbjct: 858  DLASGFQQIPMAPEDCYKTAFTTLNRHYEYTRLPEGLKNATATFQRLMEKA 908



 Score = 35.9 bits (79), Expect = 0.91
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +2

Query: 62   NRHHNTLRTLRI*LHDFWSTQRRPNVSKIYRRSYDFCFAYVDDILVYSRDALQHAAHLRT 241
            NRH+   R L   L +  +T +R     + R        Y+DDI+VYS+D  +H   +R 
Sbjct: 882  NRHYEYTR-LPEGLKNATATFQRLMEKALRRLQNIEMLVYLDDIIVYSKDLQEHEQRIRH 940

Query: 242  LFKRLKITESLL 277
            +  RL++ + +L
Sbjct: 941  MMDRLRLAKLVL 952


>UniRef50_UPI00015B44F9 Cluster: PREDICTED: similar to conserved
           hypothetical protein, partial; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to conserved
           hypothetical protein, partial - Nasonia vitripennis
          Length = 778

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 30/78 (38%), Positives = 43/78 (55%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + ++G+ +N AKC F AP V  LG++I A G       I+A++D P P T + L  FIG 
Sbjct: 549 LREHGLRLNRAKCTFAAPAVEMLGHKIDAQGVHKSDMHIEAIRDAPKPSTPEDLELFIGK 608

Query: 433 VNYYRRFLRNAAKLQAPL 486
             YY  F+ + A    PL
Sbjct: 609 ATYYNAFIPDLATKARPL 626


>UniRef50_UPI0000F1DF9A Cluster: PREDICTED: similar to pol
            polyprotein; n=1; Danio rerio|Rep: PREDICTED: similar to
            pol polyprotein - Danio rerio
          Length = 1590

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 32/88 (36%), Positives = 54/88 (61%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            +    + I  +KC F   EV +LG+ +S+ G     E+I A+  +  PQ++Q LR F+G 
Sbjct: 828  LRQQNLKIKLSKCCFFRSEVRYLGHVVSSTGVSTDPEKISAVAKWNQPQSLQELRSFLGF 887

Query: 433  VNYYRRFLRNAAKLQAPLVNAIVATEVK 516
             +YYRRF+++ +K+  PL NA+VA  ++
Sbjct: 888  ASYYRRFVKDFSKMAGPL-NALVAELIR 914



 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 27/79 (34%), Positives = 49/79 (62%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F    ++FLG  IS +G     +++ ++  +P P+T++ L+RF+G  N+YRRF+RN
Sbjct: 381 SKCEFHQTCISFLGYIISPEGVAMDQQKVDSVTQWPQPETIRQLQRFLGFANFYRRFIRN 440

Query: 463 AAKLQAPLVNAIVATEVKV 519
            + + APL   + A   ++
Sbjct: 441 FSSVAAPLTAMVKANNARL 459



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 19/32 (59%), Positives = 22/32 (68%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEF 98
           T+DL   Y Q+PVA  D  KTA  TPFGL+EF
Sbjct: 766 TLDLASGYNQVPVAESDRFKTAFCTPFGLFEF 797



 Score = 40.3 bits (90), Expect = 0.042
 Identities = 21/51 (41%), Positives = 27/51 (52%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL  AY  I +   D  KT   T  G YE+  M FGL N+   FQ F++E
Sbjct: 283 LDLRSAYNLIRIRQGDEWKTGFSTIDGHYEYLVMPFGLANSPSVFQAFVNE 333



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           V++++R   + +   Y+DDILVYS    +H  H+R + KRL I   L  + + C
Sbjct: 331 VNEVFRDMLNKWVIVYIDDILVYSNSLSEHIQHVRAVLKRL-IQNQLYAKSSKC 383



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +3

Query: 528 ITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           + W P+    F   K   SSA ++ HP P     +  DAS++ +GA  ++
Sbjct: 459 LKWNPDAVRAFTQLKTRFSSAPILRHPDPEQPFVVEIDASNTGIGAILSQ 508


>UniRef50_UPI0000D71B54 Cluster: PREDICTED: similar to transposase;
           n=3; Danio rerio|Rep: PREDICTED: similar to transposase
           - Danio rerio
          Length = 1349

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 28/71 (39%), Positives = 44/71 (61%)
 Frame = +1

Query: 274 INPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRF 453
           +NP KC F   EV+++G+  S+DG      +I+A+ + P+P     L RF+GMVNY  +F
Sbjct: 653 LNPQKCKFRLKEVSYVGHIFSSDGLHADPSKIKAITEMPVPANATALMRFLGMVNYMGKF 712

Query: 454 LRNAAKLQAPL 486
           + N + + APL
Sbjct: 713 IPNLSDISAPL 723



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFA 173
           +D   ++ QI +  +    T   TPFG Y F  M FG+ +A + FQR +++  IFA
Sbjct: 561 LDAKSSFWQISLDHKSSLLTTFSTPFGRYRFLRMPFGINSASEVFQRSMEQ--IFA 614


>UniRef50_Q9LQH2 Cluster: F15O4.13; n=7; Eukaryota|Rep: F15O4.13 -
            Arabidopsis thaliana (Mouse-ear cress)
          Length = 1887

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 28/74 (37%), Positives = 47/74 (63%)
 Frame = +1

Query: 277  NPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFL 456
            N  KC FG   + FLG  +S DG +   E+++A++++P P++V  +R F G+  +YRRF+
Sbjct: 1095 NLKKCTFGTDNLVFLGFVVSTDGVKVDEEKVKAIREWPSPKSVGEVRSFHGLAGFYRRFV 1154

Query: 457  RNAAKLQAPLVNAI 498
            ++ + L APL   I
Sbjct: 1155 KDFSTLAAPLTEVI 1168



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 23/50 (46%), Positives = 28/50 (56%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
            +DL   Y QI +   D  KTA  T  GLYE+  M FGL NA  TF R ++
Sbjct: 999  VDLKSGYHQIRMKEGDEWKTAFKTIQGLYEWLVMPFGLTNAPSTFMRLMN 1048



 Score = 33.1 bits (72), Expect = 6.4
 Identities = 16/43 (37%), Positives = 22/43 (51%)
 Frame = +2

Query: 167  FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
            F   Y DDILVYS+   +H  HL+ + + L+  E L      C
Sbjct: 1058 FVIVYFDDILVYSKSLEEHVEHLKMVLEVLR-KEKLYANLKKC 1099


>UniRef50_A2I5E5 Cluster: Retrotransposon protein; n=1; Beta
           vulgaris|Rep: Retrotransposon protein - Beta vulgaris
           (Sugar beet)
          Length = 1501

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 27/70 (38%), Positives = 46/70 (65%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F   +V FLG+ +S +G      +IQA+ ++P P++V  +R F+G+  YYRRF+R+
Sbjct: 747 SKCEFRLEKVAFLGHFVSKEGVSVDPAKIQAVSEWPTPKSVTDIRSFLGLAGYYRRFVRD 806

Query: 463 AAKLQAPLVN 492
            +K+  P+ N
Sbjct: 807 FSKIARPMTN 816



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 23/45 (51%), Positives = 27/45 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTF 140
           IDL   Y Q+ VA +D+ KTA  T +G YEF  M FGL NA   F
Sbjct: 649 IDLRSGYHQLRVADKDVPKTAFRTRYGHYEFTVMPFGLTNAPAIF 693



 Score = 37.1 bits (82), Expect = 0.39
 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +++I+    D F   ++DDIL+YSR+  +H  HLR + + L+
Sbjct: 697 MNRIFHEFLDKFVVVFIDDILIYSRNETEHDEHLRIILETLR 738


>UniRef50_Q6GV81 Cluster: Pol protein; n=1; Oikopleura dioica|Rep:
           Pol protein - Oikopleura dioica (Tunicate)
          Length = 1316

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 27/74 (36%), Positives = 44/74 (59%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G ++NP KC+ G  + TFLG+ ++ +G  P ++ + A+++FP P   + LRRFIGM  +Y
Sbjct: 616 GFLLNPDKCILGVKKTTFLGHEVTTEGYYPKTDNLAAIREFPKPTNKKALRRFIGMTAFY 675

Query: 445 RRFLRNAAKLQAPL 486
              +       APL
Sbjct: 676 STLVPKLQYKLAPL 689


>UniRef50_O46115 Cluster: Protease; n=6; Eukaryota|Rep: Protease -
           Drosophila melanogaster (Fruit fly)
          Length = 1217

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 26/85 (30%), Positives = 50/85 (58%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ +      + P+K  F   E+ FLG+ ++ DG +P   +I A+K FP P   + ++ F
Sbjct: 495 FEKLRAANFKLQPSKSEFLRKEIEFLGHIVTQDGVKPNPNKISAIKKFPCPTNRRAIKSF 554

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G++ YYR+F+R+ A++  P+   +
Sbjct: 555 LGLLGYYRKFIRDFARITKPMTKQL 579



 Score = 56.0 bits (129), Expect = 8e-07
 Identities = 26/51 (50%), Positives = 32/51 (62%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+DL   + QI + P+DI KTA     G YEF  M FGL+NA  TFQR +D
Sbjct: 409 TLDLTSGFHQIEMNPKDIAKTAFTVEGGHYEFTRMPFGLKNAPATFQRVMD 459


>UniRef50_Q15F61 Cluster: Pol polyprotein; n=1; Nosema bombycis|Rep:
           Pol polyprotein - Nosema bombycis
          Length = 717

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 36/90 (40%), Positives = 53/90 (58%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           GI++N AKC F   ++  LGN IS    +   ERI+ L  +P+P  ++ LR F+G VNY 
Sbjct: 130 GILLNEAKCKFFRTKLKILGNVISEGTIEADPERIEKLLCYPMPTNLKELRSFLGTVNYE 189

Query: 445 RRFLRNAAKLQAPLVNAIVATEVKVSHRSL 534
           R F+ N + L APL   ++  E K S +S+
Sbjct: 190 RDFIENLSGLTAPLYE-LLKGEKKSSSKSI 218



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 24/50 (48%), Positives = 27/50 (54%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +D    Y QI +   D  KTA      LYEFN M FGL NA  TFQR +D
Sbjct: 38  LDATSGYYQIAMEERDKNKTAFSFKGRLYEFNRMPFGLCNAPATFQRAMD 87



 Score = 35.9 bits (79), Expect = 0.91
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = +2

Query: 146 IYRR-SYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           I+R+ +  F   Y+DDI+VYS+    H  HLR +  +LK    +L+ +  C
Sbjct: 89  IFRKENRKFVIPYLDDIIVYSKTLEDHEKHLRIVLGKLKAV-GILLNEAKC 138


>UniRef50_A7TGN7 Cluster: Tkp3 protein; n=1; Vanderwaltozyma
           polyspora DSM 70294|Rep: Tkp3 protein - Vanderwaltozyma
           polyspora DSM 70294
          Length = 1233

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 28/84 (33%), Positives = 49/84 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  +++   KC F   EV +LG  IS    +P   + +A+  FP P  V+  +RF+
Sbjct: 442 QKLKNEQLIVKKPKCSFAEKEVEYLGYIISEHKIKPVQSKCEAISKFPTPNNVKAAQRFL 501

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           GM+NYYRRF+ + + +  P+ + I
Sbjct: 502 GMINYYRRFIPHCSTIAKPIQDYI 525



 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 26/50 (52%), Positives = 32/50 (64%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           T+DL   Y QIP+  ED  KTA +TP G YE+  M FGL NA  TF R++
Sbjct: 357 TLDLHSGYHQIPMKREDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFSRYM 406



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 15/47 (31%), Positives = 27/47 (57%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           R   F   Y+DDIL++S    +H  H+  + ++LK  E L++++  C
Sbjct: 411 REMKFVNVYLDDILIFSSSETEHWKHIDLVLQKLK-NEQLIVKKPKC 456


>UniRef50_UPI00015B459B Cluster: PREDICTED: similar to protease,
           reverse transcriptase, ribonuclease H, integrase,
           partial; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to protease, reverse transcriptase, ribonuclease
           H, integrase, partial - Nasonia vitripennis
          Length = 458

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 30/80 (37%), Positives = 49/80 (61%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           I + G+ IN  K  F   EV +LG  ++ DG +P   +I+ +  +P P+ ++ LRRF+GM
Sbjct: 48  IREAGLTINRKKNKFCCSEVKYLGVVVNCDGFRPDPSKIEPIMTYPAPKNLKRLRRFLGM 107

Query: 433 VNYYRRFLRNAAKLQAPLVN 492
            ++YR+FL N A +  PL +
Sbjct: 108 ASWYRKFLDNFATIADPLTS 127


>UniRef50_UPI00015B452C Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Nasonia vitripennis|Rep: PREDICTED:
           hypothetical protein, partial - Nasonia vitripennis
          Length = 2320

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 31/83 (37%), Positives = 52/83 (62%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           +V+ P K  F   EV FLG+ IS+ G +P  E+++A+   P P+T + +R  +GM  YYR
Sbjct: 207 LVLQPDKIEFFRREVGFLGHIISSRGIEPNPEKVEAITKLPTPKTAKNVRTLLGMFGYYR 266

Query: 448 RFLRNAAKLQAPLVNAIVATEVK 516
           +++++ AK+  PL N ++   VK
Sbjct: 267 KYIKDFAKVAKPL-NDLLKKNVK 288



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 26/51 (50%), Positives = 33/51 (64%)
 Frame = +3

Query: 9   DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           DL   +QQIP+APED  KTA  T  G YE+  +  GL+NA  TFQR ++ A
Sbjct: 115 DLASGFQQIPMAPEDCYKTAFTTLNGHYEYTRLPEGLKNATATFQRLMENA 165



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 13/33 (39%), Positives = 23/33 (69%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLL 277
           Y+DDI+VYS+D  +H   +R +  RL++ + +L
Sbjct: 177 YLDDIIVYSKDLQEHEQRIRHMMDRLRLAKLVL 209


>UniRef50_UPI0000F1FE5B Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 444

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 31/97 (31%), Positives = 56/97 (57%)
 Frame = +1

Query: 286 KCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNA 465
           KC F    ++ LG  I  +G      ++ A+ ++P P+T++ L+RF+G  N+YRRF+RN 
Sbjct: 114 KCEFHQTSISSLGYVIGLEGVAMDESKVDAVLNWPKPKTLKELQRFLGFANFYRRFIRNF 173

Query: 466 AKLQAPLVNAIVATEVKVSHRSLGHLSSKNALMPVKI 576
           + + APL   ++  E+  S+  +G + S+    P K+
Sbjct: 174 STVAAPL-TTLIKGEIDASNTGIGAVLSQRQGDPAKL 209


>UniRef50_Q94LP8 Cluster: Putative polyprotein; n=1; Oryza sativa
            (japonica cultivar-group)|Rep: Putative polyprotein -
            Oryza sativa subsp. japonica (Rice)
          Length = 1409

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 26/83 (31%), Positives = 49/83 (59%)
 Frame = +1

Query: 238  YSFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLR 417
            +  + +  + +VI P KC FG   V++LG+ I  +G      +++ + ++P+P+ V  LR
Sbjct: 800  FVLEVLRAHELVIRPKKCAFGLSSVSYLGHIIFQNGVATDPSKVEKIANWPIPKNVTDLR 859

Query: 418  RFIGMVNYYRRFLRNAAKLQAPL 486
            +F+G+  YYRRF++    +  PL
Sbjct: 860  KFLGITGYYRRFIKGYGLICRPL 882



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 23/58 (39%), Positives = 31/58 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +DL   Y QI ++  D+  TA  T  G YE+  M FGL NA  TFQ  +++     LR
Sbjct: 717 LDLRSGYHQIRMSESDVPNTAFRTHLGHYEYQVMPFGLTNAPATFQSLMNQVLAPFLR 774



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 14/43 (32%), Positives = 26/43 (60%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           F   + DDIL+YS++  +H  H++ + + L+  E L+I+   C
Sbjct: 776 FVLVFFDDILIYSKNRAEHKQHIKFVLEVLRAHE-LVIRPKKC 817


>UniRef50_Q6MWI9 Cluster: B1159F04.11 protein; n=7; Oryza sativa|Rep:
            B1159F04.11 protein - Oryza sativa (Rice)
          Length = 1679

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 30/86 (34%), Positives = 49/86 (56%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            + ++ +    +KC F   EV FLG+ ISA+G     E + A+ D+  P+TV  +R F+G+
Sbjct: 1018 LREHQLYAKLSKCEFWLSEVKFLGHVISAEGVAVDPETVTAVTDWKQPKTVTQIRSFLGL 1077

Query: 433  VNYYRRFLRNAAKLQAPLVNAIVATE 510
              YYRRF+ N +K+  P+   +   E
Sbjct: 1078 AGYYRRFIENFSKIARPMTQLLKKEE 1103



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            IDL   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 930  IDLRSGYHQLRIREEDIPKTAFTTRYGLYEFTVMSFGLTNAPAFFMNLMNK 980



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137  VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            ++K++    D F   ++DDIL+YS+    H  HLR +  +L+
Sbjct: 978  MNKVFMEYLDKFVVVFIDDILIYSQSEEDHQHHLRLVLGKLR 1019


>UniRef50_A7BIS0 Cluster: Pro-pol protein; n=1; Lentinula
           edodes|Rep: Pro-pol protein - Lentinula edodes (Shiitake
           mushroom) (Lentinus edodes)
          Length = 1274

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 28/78 (35%), Positives = 48/78 (61%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +E + + + P KC F   ++ +LG  IS    +    ++ A++D+P+P  ++ LR F+G 
Sbjct: 509 LEKHDLYLRPEKCEFEQQQIEYLGLIISEGEVRMDPVKVAAVRDWPVPTNLRELRGFLGF 568

Query: 433 VNYYRRFLRNAAKLQAPL 486
            N+YRRF+RN AK+  PL
Sbjct: 569 ANFYRRFIRNFAKIARPL 586


>UniRef50_UPI00015B440F Cluster: PREDICTED: similar to protease,
            reverse transcriptase, ribonuclease H, integrase; n=3;
            Nasonia vitripennis|Rep: PREDICTED: similar to protease,
            reverse transcriptase, ribonuclease H, integrase -
            Nasonia vitripennis
          Length = 2237

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 28/87 (32%), Positives = 50/87 (57%)
 Frame = +1

Query: 238  YSFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLR 417
            Y  Q +   G+ INP KC F   ++ +LG  +  DG +   +++  + + P P  V+ LR
Sbjct: 1557 YVLQKLISAGLTINPKKCQFCVSQIKYLGFVLDKDGLRTDPDKVAPVLNCPAPCNVRELR 1616

Query: 418  RFIGMVNYYRRFLRNAAKLQAPLVNAI 498
            R +GM+ +Y RF+ N+++ + PLV  +
Sbjct: 1617 RVLGMIGWYARFIENSSETKIPLVKLL 1643



 Score = 41.1 bits (92), Expect = 0.024
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITP-FGLYEFNYMTFGLRNAGQTFQRFID 155
            IDL +AY Q+ +       TA   P +GL++F  M FGL NA  T QR +D
Sbjct: 1473 IDLRQAYFQVKMEESSKKYTAFAVPGYGLWQFTRMPFGLINAPMTLQRLVD 1523


>UniRef50_UPI0000F1FA6A Cluster: PREDICTED: similar to pol
           polyprotein; n=4; Danio rerio|Rep: PREDICTED: similar to
           pol polyprotein - Danio rerio
          Length = 1336

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 27/79 (34%), Positives = 49/79 (62%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F    ++FLG  IS +G     +++ ++  +P P+T++ L+RF+G  N+YRRF+RN
Sbjct: 727 SKCEFHQTCISFLGYIISPEGVAMDQQKVDSVTQWPQPETIRQLQRFLGFANFYRRFIRN 786

Query: 463 AAKLQAPLVNAIVATEVKV 519
            + + APL   + A   ++
Sbjct: 787 FSSVAAPLTAMVKANNARL 805



 Score = 40.3 bits (90), Expect = 0.042
 Identities = 21/51 (41%), Positives = 27/51 (52%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL  AY  I +   D  KT   T  G YE+  M FGL N+   FQ F++E
Sbjct: 629 LDLRSAYNLIRIRQGDEWKTGFSTIDGHYEYLVMPFGLANSPSVFQAFVNE 679



 Score = 37.1 bits (82), Expect = 0.39
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           V++I+R   + +   Y+DDIL+YS    +H  H+R + +RL I   L  + + C
Sbjct: 677 VNEIFRDMLNKWVIVYIDDILIYSNSLSEHIQHVRAVLERL-IENQLYAKSSKC 729



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +3

Query: 528 ITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           + W P+    F   K   SSA ++ HP P     +  DAS++ +GA  ++
Sbjct: 805 LKWNPDAVRAFTQLKTRFSSAPILRHPDPEQPFVVEIDASNTGIGAILSQ 854


>UniRef50_A5B7A2 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 934

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 38/120 (31%), Positives = 63/120 (52%), Gaps = 5/120 (4%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           +V+N  KC F   +  FLG+ IS  G +   E+++ +   P P TV+G+R+F+G   +YR
Sbjct: 639 LVLNWEKCHFMVQQGIFLGHIISEKGIEVDKEKVELIVKLPSPTTVKGVRQFLGHAGFYR 698

Query: 448 RFLRNAAKLQAPLVNAIVATEVKV-----SHRSLGHLSSKNALMPVKIACHLQLWWHTLC 612
           RF+++ +KL   L   ++A + K        RS  HL       P+  A + QL +  +C
Sbjct: 699 RFIKDFSKLSKSLCE-LLAKDAKFVWDKRCQRSFDHLKQFLTTTPIVRAPNWQLPFEVMC 757



 Score = 37.9 bits (84), Expect = 0.22
 Identities = 20/47 (42%), Positives = 25/47 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    Y QI +  ED  KT +  PF  Y +  + FGL NA  TFQR
Sbjct: 572 LDGYSEYFQIEIDVEDQEKTTLTYPFRTYAYRRIPFGLCNAPATFQR 618


>UniRef50_A5B704 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1031

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 29/85 (34%), Positives = 51/85 (60%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ + +  + I P KC F   E+TFL ++IS    +    ++QA+ ++ +P  V  L+ F
Sbjct: 526 FQRLRENKLYIKPEKCEFAQEEITFLRHKISVGLIRMDKGKVQAIMEWLVPTKVAELQSF 585

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+ NYYRRF++  +K  +PL + +
Sbjct: 586 LGLANYYRRFIKGYSKKVSPLTDLL 610



 Score = 40.7 bits (91), Expect = 0.032
 Identities = 19/47 (40%), Positives = 28/47 (59%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           R+  F   Y+DDI+VYS+   +H  HLR +F+RL+    L I+   C
Sbjct: 496 RTNAFVVVYLDDIVVYSKTLTEHEKHLRLVFQRLR-ENKLYIKPEKC 541


>UniRef50_Q8ITE3 Cluster: Reverse transcriptase/RNaseH; n=1;
           Solenopsis invicta|Rep: Reverse transcriptase/RNaseH -
           Solenopsis invicta (Red imported fire ant)
          Length = 279

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 25/64 (39%), Positives = 46/64 (71%)
 Frame = +1

Query: 307 EVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAPL 486
           EV +LG+ I  +G +P  ++I A+++FP+P+ ++ +R+F+G+  YYRRF+ N +K+  PL
Sbjct: 4   EVAYLGHIIGENGVRPDPQKISAVQNFPVPKNIKNVRQFLGLAGYYRRFIPNFSKIANPL 63

Query: 487 VNAI 498
            N +
Sbjct: 64  SNLL 67


>UniRef50_UPI0000F1E415 Cluster: PREDICTED: similar to pol
           polyprotein; n=1; Danio rerio|Rep: PREDICTED: similar to
           pol polyprotein - Danio rerio
          Length = 781

 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 27/76 (35%), Positives = 47/76 (61%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           D  + + P KC F   +V FLG  +     Q   +++QA+KD+P P +++ ++RF+G  N
Sbjct: 365 DNHLYVKPEKCQFHVSQVKFLGFVVKPGQIQMDPQKVQAVKDWPSPSSIKEVQRFLGFAN 424

Query: 439 YYRRFLRNAAKLQAPL 486
           +YR+F+ N + + APL
Sbjct: 425 FYRKFILNFSTVAAPL 440



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 22/50 (44%), Positives = 27/50 (54%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AY  + +   D  KTA  TP G YE+  M FGL NA   FQ  I+
Sbjct: 275 LDLRNAYHLVRIKEGDEWKTAFNTPTGHYEYLVMPFGLTNAPAVFQALIN 324


>UniRef50_UPI00005480D8 Cluster: PREDICTED: similar to LReO_3; n=12;
            Danio rerio|Rep: PREDICTED: similar to LReO_3 - Danio
            rerio
          Length = 1520

 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 30/90 (33%), Positives = 55/90 (61%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q I+  G+ +N AKC +   E  +LG ++     +P  ++++AL++ P P+T + +R F+
Sbjct: 1220 QKIQKAGLTLNVAKCEWARQETRYLGFQLGNGEIRPQVDKVEALRNCPRPRTKKEVRSFL 1279

Query: 427  GMVNYYRRFLRNAAKLQAPLVNAIVATEVK 516
            G+V +YRRF+   ++  APL N + A  +K
Sbjct: 1280 GLVGWYRRFIPQFSEKAAPLTN-LTAKAIK 1308



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 24/52 (46%), Positives = 30/52 (57%)
 Frame = +3

Query: 3    TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            T+DL K Y Q+P+       TA  TP GLY F  M FGL  A  TFQR +++
Sbjct: 1134 TLDLCKGYWQVPLEKTSREYTAFRTPVGLYHFKTMPFGLHGAPATFQRLMNQ 1185



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 15/59 (25%), Positives = 34/59 (57%)
 Frame = +2

Query: 83   RTLRI*LHDFWSTQRRPNVSKIYRRSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            +T+   LH   +T +R  ++++ R   ++  AY+DD+++YS     H  HL  + ++++
Sbjct: 1166 KTMPFGLHGAPATFQRL-MNQVLRNCEEYSAAYLDDVVIYSTTWTDHVHHLHKILQKIQ 1223


>UniRef50_Q94BM2 Cluster: Gag-pol polyprotein; n=29;
            Magnoliophyta|Rep: Gag-pol polyprotein - Hordeum vulgare
            (Barley)
          Length = 1720

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 32/93 (34%), Positives = 53/93 (56%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F A+ D  +  N  KC F    V+FLG  ++  G +    +I+A++ +P P+TV  +R F
Sbjct: 951  FTALRDARLFGNLGKCTFCTDRVSFLGYVVTPQGIEVDKAKIEAIESWPQPKTVTQVRSF 1010

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVS 522
            +G   +YRRF+R+ + + APL N +   +V  S
Sbjct: 1011 LGXAGFYRRFVRDFSTIAAPL-NELTKKDVPYS 1042



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 25/51 (49%), Positives = 30/51 (58%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            +DL   Y QI +   D  KTA  T FGLYE+  M FGL NA  TF R ++E
Sbjct: 866  VDLRSGYHQIRMKLGDEWKTAFKTKFGLYEWLVMPFGLTNAPSTFMRLMNE 916



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = +2

Query: 167  FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            F   Y DDIL+YSR    H  HLR +F  L+
Sbjct: 925  FVVVYFDDILIYSRSLEDHLDHLRAVFTALR 955


>UniRef50_Q7XQM2 Cluster: OSJNBa0089E12.2 protein; n=79;
            Eukaryota|Rep: OSJNBa0089E12.2 protein - Oryza sativa
            (Rice)
          Length = 1764

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 30/86 (34%), Positives = 48/86 (55%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            + ++ +    +KC F   EV FLG+ ISA G     E + A+ D+  P+TV  +R F+G+
Sbjct: 1004 LREHQLYAKLSKCEFWLSEVKFLGHVISAKGVAVDPETVTAVTDWKQPKTVTQIRSFLGL 1063

Query: 433  VNYYRRFLRNAAKLQAPLVNAIVATE 510
              YYRRF+ N +K+  P+   +   E
Sbjct: 1064 AGYYRRFIENFSKIARPMTQLLKKEE 1089



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            IDL   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 916  IDLCSGYHQLRIREEDIPKTAFTTRYGLYEFTVMSFGLTNAPAFFMNLMNK 966



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137  VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            ++K++    D F   ++DDIL+YS+    H  HLR +  +L+
Sbjct: 964  MNKVFMEYLDKFVVVFIDDILIYSQSEEDHQHHLRLVLGKLR 1005


>UniRef50_Q2QSA6 Cluster: Retrotransposon protein, putative,
           unclassified; n=4; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 1287

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 27/73 (36%), Positives = 45/73 (61%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           + +   KC F AP V +LG+ ISA G      ++QA++D+P  ++ + +R F+G+  YYR
Sbjct: 558 LFVKRTKCSFSAPSVAYLGHVISAAGVAMDPSKVQAIRDWPARRSPRAVRGFLGLAGYYR 617

Query: 448 RFLRNAAKLQAPL 486
           +F+ N   + APL
Sbjct: 618 KFVHNYGTVAAPL 630


>UniRef50_A5AZ23 Cluster: Putative uncharacterized protein; n=2; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1286

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 40/119 (33%), Positives = 62/119 (52%), Gaps = 4/119 (3%)
 Frame = +1

Query: 268  IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
            +V+N  KC F   +   LG+ IS  G +   E+I+ +   PLP TV+G+R+F+G V +YR
Sbjct: 847  LVLNWEKCHFMVHQGIVLGHIISKKGIEVDKEKIELIIKLPLPTTVKGVRQFLGHVVFYR 906

Query: 448  RFLRNAAKLQAPLVNAIVATEVKV----SHRSLGHLSSKNALMPVKIACHLQLWWHTLC 612
            RF+++ +KL  PL   +V     V       S G L       P+  A + QL +  +C
Sbjct: 907  RFIKDFSKLARPLCELLVKDSKFVWDDRCQWSFGELKLFLTTTPIVRAPNWQLPFEVMC 965



 Score = 37.9 bits (84), Expect = 0.22
 Identities = 16/31 (51%), Positives = 20/31 (64%)
 Frame = +3

Query: 60  KTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           KT    PFG Y +  M+FGL NA  TFQR++
Sbjct: 772 KTTFTCPFGTYAYKRMSFGLCNAPATFQRYM 802


>UniRef50_A5ATZ0 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1357

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 27/86 (31%), Positives = 51/86 (59%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           + Q + +  +     KC FG   + +LG+ IS+ G     +++ A++D+P P T++ LR 
Sbjct: 685 ALQVLRENLLYAKSNKCFFGHSSIEYLGHVISSGGVYTDPQKVVAVRDWPTPITLKQLRG 744

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAI 498
           F+G+  YYRRF+++  K+  PL + +
Sbjct: 745 FLGLTGYYRRFVKDYGKIAKPLTDLL 770



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 24/50 (48%), Positives = 28/50 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           IDL   Y QI +   D+ KTA  T  G YEF  M FGL NA  TFQ  ++
Sbjct: 601 IDLRSGYWQIRMHEPDVPKTAFKTHEGHYEFLVMPFGLTNAPSTFQSLMN 650


>UniRef50_UPI0000F1FF62 Cluster: signal transduction and activation of
            transcription 3; n=9; Danio rerio|Rep: signal
            transduction and activation of transcription 3 - Danio
            rerio
          Length = 1193

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 29/81 (35%), Positives = 46/81 (56%)
 Frame = +1

Query: 250  AIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIG 429
            A+   G+  NP KC  G  EV +LG  +     QP  ++  A+   P P+T + +R+F+G
Sbjct: 878  ALRRAGLTANPRKCAIGRVEVRYLGFHLGHGQVQPQIDKTAAIATCPRPKTKKEVRQFLG 937

Query: 430  MVNYYRRFLRNAAKLQAPLVN 492
            +  YYRRF+ N + L +PL +
Sbjct: 938  LAGYYRRFVPNYSALVSPLTD 958



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 27/52 (51%), Positives = 35/52 (67%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T+DL K Y QIP++P    KTA  TPFGL++F  + FGL  A  TFQR +D+
Sbjct: 791 TLDLTKGYWQIPLSPISREKTAFTTPFGLHQFVTLPFGLFGAPATFQRLMDK 842



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +  AY+DDI++YS D  +H  HL+ +   L+
Sbjct: 850 YAAAYLDDIIIYSNDWQRHMQHLKAVLSALR 880


>UniRef50_UPI0000F1F28A Cluster: PREDICTED: similar to LReO_3; n=1;
            Danio rerio|Rep: PREDICTED: similar to LReO_3 - Danio
            rerio
          Length = 1317

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 29/85 (34%), Positives = 48/85 (56%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F+ +    + +N AKC F    +T+LG ++     +P   +I A+ +FP+P   + LRRF
Sbjct: 1073 FKCLTSASLTLNLAKCEFAKGVITYLGKQVGQGLVKPVDAKITAIIEFPVPCNKRELRRF 1132

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAI 498
            +GM  YYR F  N + L +PL + +
Sbjct: 1133 LGMSGYYRSFCPNFSSLVSPLTDLL 1157



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 18/49 (36%), Positives = 30/49 (61%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
            +DL+K Y Q+P++      +A +TP    ++  + FG+RNA  TFQR +
Sbjct: 990  LDLLKGYWQVPLSQRASEISAFVTPDSFLQYKVLAFGMRNAPATFQRMM 1038


>UniRef50_UPI0000E471ED Cluster: PREDICTED: similar to zinc finger
           protein; n=3; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to zinc finger protein -
           Strongylocentrotus purpuratus
          Length = 1594

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 27/71 (38%), Positives = 45/71 (63%)
 Frame = +1

Query: 280 PAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLR 459
           P+KC      + FLG+R+     QP + +IQA+++ P P+T + LR F+G+ +YYR+F+ 
Sbjct: 5   PSKCSLAQESLDFLGHRVGGGKLQPMTNKIQAVQEAPRPETKRQLRSFLGLASYYRKFVP 64

Query: 460 NAAKLQAPLVN 492
             A++  PL N
Sbjct: 65  CFAEIAVPLTN 75



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 27/71 (38%), Positives = 45/71 (63%)
 Frame = +1

Query: 280  PAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLR 459
            P+KC      + FLG+R+     QP + +IQA+++ P P+T + LR F+G+ +YYR+F+ 
Sbjct: 1362 PSKCSLAQESLDFLGHRVGGGKLQPMTNKIQAVQEAPRPKTKRQLRSFLGLASYYRKFVP 1421

Query: 460  NAAKLQAPLVN 492
              A++  PL N
Sbjct: 1422 CFAEIAVPLTN 1432



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 24/47 (51%), Positives = 29/47 (61%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
            +DL K Y QIP+      +TA ITP GL++F  M FGL NA  TF R
Sbjct: 1267 LDLTKGYWQIPLTENAKPRTAFITPNGLFQFKTMPFGLINAPATFSR 1313


>UniRef50_UPI0000E471C8 Cluster: PREDICTED: similar to zinc finger
            protein; n=6; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to zinc finger protein -
            Strongylocentrotus purpuratus
          Length = 1487

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 29/83 (34%), Positives = 46/83 (55%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F+ +    +   P KC  G   + FLG+RI     +P  +++ A++    P+T + LR F
Sbjct: 1239 FERLRRANLTARPTKCTVGCVSIEFLGHRIGQGELRPVQDKVDAVQGAARPKTKKQLRSF 1298

Query: 424  IGMVNYYRRFLRNAAKLQAPLVN 492
            +G+V YYRRF+ N A L  PL +
Sbjct: 1299 LGLVCYYRRFVPNFAALAVPLTD 1321



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 24/49 (48%), Positives = 30/49 (61%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
            IDL K Y Q+P+  E    TA +TP GLY+F  M FGL NA  +F R +
Sbjct: 1156 IDLTKGYWQVPLTEEAKELTAFVTPDGLYQFRSMPFGLVNAPASFSRIM 1204


>UniRef50_Q9AYB6 Cluster: Polyprotein; n=47; Magnoliophyta|Rep:
            Polyprotein - Oryza sativa (Rice)
          Length = 2017

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 30/86 (34%), Positives = 48/86 (55%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            + ++ +    +KC F   EV FLG+ ISA G     E + A+ D+  P+TV  +R F+G+
Sbjct: 1316 LREHQLYAKLSKCEFWLSEVKFLGHVISAKGVAVDPETVTAVTDWKQPKTVTQVRSFLGL 1375

Query: 433  VNYYRRFLRNAAKLQAPLVNAIVATE 510
              YYRRF+ N +K+  P+   +   E
Sbjct: 1376 AGYYRRFIENFSKIARPMTQLLKKEE 1401



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            IDL   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 1228 IDLRSGYHQLRIRDEDIPKTAFTTRYGLYEFTVMSFGLTNAPAFFMNLMNK 1278


>UniRef50_Q84UZ3 Cluster: Reverse-transcriptase; n=2; Chlamydomonas
           reinhardtii|Rep: Reverse-transcriptase - Chlamydomonas
           reinhardtii
          Length = 776

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 26/68 (38%), Positives = 46/68 (67%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F  PE+ FLG+ +S +G +    +I+ ++++ +PQ +  LR F+G+ NY+RRF++ 
Sbjct: 587 SKCDFNRPELHFLGHIVSREGLKVDDRKIRVIREWEVPQDLHKLRAFLGLANYFRRFIQG 646

Query: 463 AAKLQAPL 486
            + L APL
Sbjct: 647 YSSLVAPL 654



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 1/48 (2%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITP-FGLYEFNYMTFGLRNAGQTFQ 143
           ++DL + Y QI + P+D+ KT  I P  G +E+  + FGL NA  TFQ
Sbjct: 487 SLDLQQGYNQIRIHPDDVPKTGFIAPGMGQFEYKVLCFGLTNAPATFQ 534



 Score = 37.5 bits (83), Expect = 0.30
 Identities = 15/31 (48%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   Y+DDILV+S++A +H  HLRT+ + L+
Sbjct: 548 FVLVYLDDILVFSKNAEEHKEHLRTVLEILR 578


>UniRef50_Q53M59 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            sub-class; n=11; Magnoliophyta|Rep: Retrotransposon
            protein, putative, Ty3-gypsy sub-class - Oryza sativa
            subsp. japonica (Rice)
          Length = 1651

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 30/86 (34%), Positives = 48/86 (55%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            + ++ +    +KC F   EV FLG+ ISA G     E + A+ D+  P+TV  +R F+G+
Sbjct: 891  LREHQLYAKLSKCEFWLSEVKFLGHVISAKGVAVDPETVTAVTDWKQPKTVTQVRSFLGL 950

Query: 433  VNYYRRFLRNAAKLQAPLVNAIVATE 510
              YYRRF+ N +K+  P+   +   E
Sbjct: 951  AGYYRRFIENFSKIARPMTQLLKKEE 976



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 803 IDLRSGYHQLRIREEDIPKTAFTTRYGLYEFTVMSFGLTNAPAFFMNLMNK 853



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YS+    H  HLR +  +L+
Sbjct: 851 MNKVFMEYLDKFVVVFIDDILIYSQSEEDHQHHLRLVLGKLR 892


>UniRef50_Q53L74 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            sub-class; n=2; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            Ty3-gypsy sub-class - Oryza sativa subsp. japonica (Rice)
          Length = 1297

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 29/85 (34%), Positives = 52/85 (61%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F A+ D  +  N  KC F    V+FLG  ++  G +    +++A++ +P P+TV  +R F
Sbjct: 778  FNALRDARLFGNLEKCTFCTDRVSFLGYVVTPQGIEVDQAKVEAIQSWPTPKTVSQVRSF 837

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAI 498
            +G+  +YRRF+++ + + APL NA+
Sbjct: 838  LGLAGFYRRFVQDFSTITAPL-NAL 861



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/51 (47%), Positives = 28/51 (54%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL   Y QI +   D  KTA    FGLYE+  M FGL NA  TF R + E
Sbjct: 693 VDLRSGYHQIRMKLGDEWKTAFKMKFGLYEWLVMPFGLTNAPSTFMRLMSE 743



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   Y DDIL+YS+   +H  HLR +F  L+
Sbjct: 752 FVVVYFDDILIYSKSMGEHFNHLRAVFNALR 782


>UniRef50_Q53J66 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            sub-class; n=21; Magnoliophyta|Rep: Retrotransposon
            protein, putative, Ty3-gypsy sub-class - Oryza sativa
            subsp. japonica (Rice)
          Length = 1748

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 29/85 (34%), Positives = 52/85 (61%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F A+ D  +  N  KC F    V+FLG  ++  G +    +++A++ +P P+TV  +R F
Sbjct: 1234 FNALRDARLFGNLEKCTFCTDRVSFLGYVVTPQGIEVDQAKVEAIQSWPTPKTVSQVRSF 1293

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAI 498
            +G+  +YRRF+++ + + APL NA+
Sbjct: 1294 LGLAGFYRRFVQDFSTIAAPL-NAL 1317



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 24/51 (47%), Positives = 29/51 (56%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            +DL   Y QI +   D  KT   T FGLYE+  M FGL NA  TF R ++E
Sbjct: 1149 VDLRSGYHQIRMKLGDEWKTTFKTKFGLYEWLVMPFGLTNAPSTFMRLMNE 1199



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 167  FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            F   Y DDIL+YS+   +H  HLR +F  L+
Sbjct: 1208 FVVVYFDDILIYSKSMGEHFNHLRAVFNALR 1238


>UniRef50_Q33A89 Cluster: Retrotransposon protein, putative,
           unclassified, expressed; n=2; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           unclassified, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 1347

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 29/85 (34%), Positives = 51/85 (60%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F A+    + +   KC FG P V +LG+ IS  G    + +IQA+ ++P P++ + LR F
Sbjct: 590 FTALWAAQLFVKHTKCSFGDPSVAYLGHIISQHGFAMDAAKIQAVAEWPRPRSPKELRGF 649

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+ +YYR+F+++   + APL   +
Sbjct: 650 LGLASYYRKFIQDFGSVAAPLTQLL 674



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/51 (47%), Positives = 32/51 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL   Y Q+ + P+DI KTA  T  GLYEF  + FGL NA  TFQ  +++
Sbjct: 505 LDLRSGYHQVRMHPDDIDKTAFRTHDGLYEFLVIPFGLTNALATFQSLMND 555



 Score = 34.3 bits (75), Expect = 2.8
 Identities = 17/43 (39%), Positives = 22/43 (51%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           F   + DDILVYS     H  HLRT+F  L   + L ++   C
Sbjct: 564 FVLVFFDDILVYSPTWTSHLQHLRTVFTALWAAQ-LFVKHTKC 605


>UniRef50_Q2R2D1 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            subclass; n=9; Oryza sativa|Rep: Retrotransposon protein,
            putative, Ty3-gypsy subclass - Oryza sativa subsp.
            japonica (Rice)
          Length = 1668

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 30/86 (34%), Positives = 48/86 (55%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            + ++ +    +KC F   EV FLG+ ISA G     E + A+ D+  P+TV  +R F+G+
Sbjct: 996  LREHQLYAKLSKCEFWLSEVKFLGHVISAKGVAVDPETVTAVTDWKQPKTVTQVRSFLGL 1055

Query: 433  VNYYRRFLRNAAKLQAPLVNAIVATE 510
              YYRRF+ N +K+  P+   +   E
Sbjct: 1056 AGYYRRFIENFSKIARPMTQLLKKEE 1081



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 19/40 (47%), Positives = 25/40 (62%)
 Frame = +3

Query: 39   VAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 919  IREEDIPKTAFTTRYGLYEFTVMSFGLTNAPAFFMNLMNK 958


>UniRef50_Q01KW5 Cluster: H0211A12.9 protein; n=2; Oryza sativa|Rep:
            H0211A12.9 protein - Oryza sativa (Rice)
          Length = 1667

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 29/85 (34%), Positives = 52/85 (61%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F A+ D  +  N  KC F    V+FLG  ++  G +    +++A++ +P P+TV  +R F
Sbjct: 815  FNALRDARLFGNLEKCTFCTDRVSFLGYVVTPQGIEVDQAKVEAIQSWPTPKTVSQVRSF 874

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAI 498
            +G+  +YRRF+++ + + APL NA+
Sbjct: 875  LGLAGFYRRFVQDFSTIAAPL-NAL 898



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 25/51 (49%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL   Y QI +   D  KTA  T FGLYE+  M FGL NA  TF R ++E
Sbjct: 730 VDLRSGYHQIRMNLGDEWKTAFKTKFGLYEWLVMPFGLTNAPTTFMRLMNE 780



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   Y DDIL+YS+   +H  HLR +F  L+
Sbjct: 789 FVVVYFDDILIYSKSMGEHFNHLRAVFNALR 819


>UniRef50_Q5ABJ9 Cluster: Possible Tca8 reverse transcriptase; n=3;
           Candida albicans|Rep: Possible Tca8 reverse
           transcriptase - Candida albicans (Yeast)
          Length = 653

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 25/77 (32%), Positives = 45/77 (58%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F     Y   + P KC FG    +FLG+ IS++G   P + ++ +++   P T +G+R+ 
Sbjct: 262 FSRFRKYTFYLKPTKCSFGDTTTSFLGHEISSNGVSIPEDHLRTIRELKCPDTSKGMRKV 321

Query: 424 IGMVNYYRRFLRNAAKL 474
           +G +N++R  +RN AK+
Sbjct: 322 MGFMNFFRGHVRNFAKM 338



 Score = 34.3 bits (75), Expect = 2.8
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           C +Y+DDI+VYS    +H   LR LF R +
Sbjct: 237 CKSYIDDIIVYSNTLEEHEEILRELFSRFR 266


>UniRef50_A4QRY3 Cluster: Putative uncharacterized protein; n=35;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 1357

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 29/80 (36%), Positives = 48/80 (60%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           +A+   G+  N AKC F   E  FLG  +  +G +   E+I A+ D+  P+ +  ++ F+
Sbjct: 679 EALRKAGLYANAAKCEFFVTETKFLGLLVGVEGVKMDPEKITAVLDWQTPKKLTDVQAFL 738

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G  N+YRRF+R+ +K+ APL
Sbjct: 739 GFGNFYRRFIRDFSKIVAPL 758



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 23/52 (44%), Positives = 31/52 (59%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           ID+V A+  I +   +   TA  T FGLYE   M FGL  A  TFQR+I+++
Sbjct: 593 IDIVSAFNNIRIKKGEEYLTAFRTRFGLYESLVMPFGLTGAPATFQRYINDS 644



 Score = 39.9 bits (89), Expect = 0.056
 Identities = 15/31 (48%), Positives = 22/31 (70%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           FC AY+DDIL+YSR   +H  HL+ + + L+
Sbjct: 652 FCTAYLDDILIYSRTRTEHEEHLKLVLEALR 682


>UniRef50_Q8I7P9 Cluster: Retrovirus-related Pol polyprotein from
           transposon opus [Includes: Protease (EC 3.4.23.-);
           Reverse transcriptase (EC 2.7.7.49); Endonuclease]; n=2;
           Drosophila melanogaster|Rep: Retrovirus-related Pol
           polyprotein from transposon opus [Includes: Protease (EC
           3.4.23.-); Reverse transcriptase (EC 2.7.7.49);
           Endonuclease] - Drosophila melanogaster (Fruit fly)
          Length = 1003

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 28/73 (38%), Positives = 49/73 (67%)
 Frame = +1

Query: 274 INPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRF 453
           +N  K  F   +V FLG  ++ADG +   ++++A+ + P P +V+ L+RF+GM +YYR+F
Sbjct: 312 VNLEKSHFLDTQVEFLGYIVTADGIKADPKKVRAISEMPPPTSVKELKRFLGMTSYYRKF 371

Query: 454 LRNAAKLQAPLVN 492
           +++ AK+  PL N
Sbjct: 372 IQDYAKVAKPLTN 384



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 25/52 (48%), Positives = 31/52 (59%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T+DL   + QI +   DI KTA  T  G YEF  + FGL+NA   FQR ID+
Sbjct: 216 TLDLTSGFHQIHMKESDIPKTAFSTLNGKYEFLRLPFGLKNAPAIFQRMIDD 267


>UniRef50_UPI00015B618C Cluster: PREDICTED: similar to protease,
           reverse transcriptase, ribonuclease H, integrase; n=1;
           Nasonia vitripennis|Rep: PREDICTED: similar to protease,
           reverse transcriptase, ribonuclease H, integrase -
           Nasonia vitripennis
          Length = 1041

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/86 (33%), Positives = 52/86 (60%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           I + G  +N  K  FG  +V +LG  +  +G +P  ERI  + ++  P+T + LR+F+GM
Sbjct: 472 ISEAGWTVNRKKWEFGCSQVRYLGYLLDREGLRPDPERIAPVLEYTPPKTKKQLRQFLGM 531

Query: 433 VNYYRRFLRNAAKLQAPLVNAIVATE 510
           V +Y RF+ N ++++ PL+  +  T+
Sbjct: 532 VGWYSRFIPNDSEIKVPLLKLLRNTQ 557



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITP-FGLYEFNYMTFGLRNAGQTFQRFID 155
           IDL KAY Q+P+  +    TA   P  GL++F  M FGL NA  TFQR +D
Sbjct: 383 IDLRKAYFQVPLDGDSKKYTAFSMPGSGLWQFTRMPFGLANAPTTFQRLVD 433


>UniRef50_UPI00015B48A3 Cluster: PREDICTED: similar to reverse
           transcriptase/RNaseH; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to reverse transcriptase/RNaseH -
           Nasonia vitripennis
          Length = 686

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 27/80 (33%), Positives = 51/80 (63%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           + + P KC F   +V++LG+ I+ +G +P  ++++A+++FP P+TV+ LR+F+ +  Y  
Sbjct: 494 VKLQPNKCDFLPRKVSYLGHVINEEGVRPNPKKVEAVRNFPWPRTVKNLRQFLSLAGYCP 553

Query: 448 RFLRNAAKLQAPLVNAIVAT 507
           RF+    K+  PL N +  T
Sbjct: 554 RFIDGFLKIAKPLSNLLKQT 573


>UniRef50_UPI00015B43D9 Cluster: PREDICTED: similar to polypeptide;
           n=4; Nasonia vitripennis|Rep: PREDICTED: similar to
           polypeptide - Nasonia vitripennis
          Length = 542

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/74 (40%), Positives = 46/74 (62%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +   G+ IN  K VF   EV +LG  ++ DG QP  E+I  +  +P P+ ++ LRRF+
Sbjct: 298 QRVNAAGLTINRDKSVFCQEEVNYLGVLVNHDGFQPDPEKIAPIVVYPAPKNLKHLRRFL 357

Query: 427 GMVNYYRRFLRNAA 468
           GM ++YR+FL+  A
Sbjct: 358 GMASWYRKFLQEFA 371



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 27/53 (50%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITP-FGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T+DL  AY QIP+ PE    TA   P  GL++F  M FGL  AG TF R ID+
Sbjct: 210 TLDLSSAYHQIPLKPEARPLTAFTVPGLGLFQFVRMPFGLAYAGATFLRMIDK 262


>UniRef50_UPI0000F20443 Cluster: PREDICTED: similar to pol
           polyprotein; n=1; Danio rerio|Rep: PREDICTED: similar to
           pol polyprotein - Danio rerio
          Length = 1320

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 29/74 (39%), Positives = 46/74 (62%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+    +KC F   EV +LG+ IS++G      +++A+ ++P P +V  LR F+G  +YY
Sbjct: 418 GLKAKLSKCAFFQREVRYLGHVISSEGVSTDPGKVEAVANWPCPTSVTELRSFLGFASYY 477

Query: 445 RRFLRNAAKLQAPL 486
           RRF+   +KL APL
Sbjct: 478 RRFVEGFSKLAAPL 491



 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 28/51 (54%), Positives = 35/51 (68%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+DL   Y Q+PV  +D  KTA  TPFGL+E+N M FGL NA  TFQR ++
Sbjct: 325 TMDLASGYNQVPVTEKDKPKTAFCTPFGLFEWNRMAFGLCNAPSTFQRLME 375


>UniRef50_UPI0000E48D7B Cluster: PREDICTED: similar to ankyrin
           2,3/unc44, partial; n=2; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to ankyrin 2,3/unc44,
           partial - Strongylocentrotus purpuratus
          Length = 1395

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 28/74 (37%), Positives = 44/74 (59%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+ +NP KC F   E ++LG+ IS +G  P    ++A+ + P P  +  LR  +GM+NYY
Sbjct: 236 GLRLNPKKCQFHLSEFSYLGHCISCNGLSPDDSHVKAILEAPAPTDIGMLRSVLGMINYY 295

Query: 445 RRFLRNAAKLQAPL 486
            +F+ N A +  PL
Sbjct: 296 AKFVPNYATVVEPL 309



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 21/49 (42%), Positives = 28/49 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +DL  AY Q+ +  E    TA IT  GLY F  + FGL +A  TFQ+ +
Sbjct: 146 MDLASAYHQLELDEESRDLTAFITHDGLYRFKRVCFGLASAPSTFQKMM 194


>UniRef50_Q53J67 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            sub-class; n=3; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            Ty3-gypsy sub-class - Oryza sativa subsp. japonica (Rice)
          Length = 1497

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/76 (39%), Positives = 44/76 (57%)
 Frame = +1

Query: 283  AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
            +KC F   EV FLG+ ISA G     E + A+ D+  P+TV  +R F+G+  YYRRF+ N
Sbjct: 922  SKCEFWLSEVKFLGHVISAKGVAVDPETVTAVTDWKQPKTVTQVRSFLGLAGYYRRFIEN 981

Query: 463  AAKLQAPLVNAIVATE 510
             +K+  P+   +   E
Sbjct: 982  FSKIARPMTQLLKKEE 997



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 24/49 (48%), Positives = 31/49 (63%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           I+L   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA  T  +F+
Sbjct: 837 INLRSGYHQLRIREEDIPKTAFTTRYGLYEFTVMSFGLTNA-PTLDKFV 884



 Score = 32.7 bits (71), Expect = 8.4
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   ++DDILVYS+    H  HLR +  +L+
Sbjct: 883 FVVVFIDDILVYSQSEEDHQQHLRLVLGKLR 913


>UniRef50_Q0DAQ7 Cluster: Os06g0638300 protein; n=6; Oryza
           sativa|Rep: Os06g0638300 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 1254

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 33/99 (33%), Positives = 55/99 (55%), Gaps = 3/99 (3%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KCVFG  +V +LG  IS  G     E+I+A++++P P  +  LR F+G+  YYRRF++N
Sbjct: 575 SKCVFGQRQVEYLGYVISDAGVATDPEKIRAVREWPTPTNITELRGFLGLAGYYRRFIQN 634

Query: 463 AAKLQAPLVNAIVATEVK---VSHRSLGHLSSKNALMPV 570
              +  P+ +++     K      +S   + S+ A  PV
Sbjct: 635 FGVICRPMFDSLKKMGFKWEEKQQQSFDEIKSRLAQAPV 673



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 22/46 (47%), Positives = 27/46 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQ 143
           IDL   Y QI +  +D+ KT+  T  G +EF  M FGL NA  TFQ
Sbjct: 477 IDLRSGYHQIRMDVKDVPKTSFSTHMGHFEFVVMPFGLTNAPATFQ 522


>UniRef50_A5AWI1 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 905

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 37/120 (30%), Positives = 64/120 (53%), Gaps = 5/120 (4%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           +V+N  KC F  P+   LG+ IS  G +    +++ +  FP P TV+G+R+F+G + +YR
Sbjct: 391 LVLNWEKCHFIIPQGIILGHIISKQGIEVDKAKVELIVKFPSPTTVKGVRQFLGHIGFYR 450

Query: 448 RFLRNAAKLQAPLVNAIVATEVKV-----SHRSLGHLSSKNALMPVKIACHLQLWWHTLC 612
           RF+++ +K   PL   +V  +VK        RS   L      +P+  A + +L +  +C
Sbjct: 451 RFIKDFSKRTRPLCELLV-KDVKFVCDDRRQRSFEELKLLLTTIPIMRAPNWKLPFEVMC 509



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 15/28 (53%), Positives = 17/28 (60%)
 Frame = +3

Query: 60  KTAIITPFGLYEFNYMTFGLRNAGQTFQ 143
           KT    PFG Y +  M+FGL NA  TFQ
Sbjct: 316 KTTFTCPFGTYAYRRMSFGLCNAPSTFQ 343


>UniRef50_A1YGR9 Cluster: Putative pol protein; n=1; Philodina
           roseola|Rep: Putative pol protein - Philodina roseola
          Length = 1269

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 33/95 (34%), Positives = 55/95 (57%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F A++    V+NP KC     ++ +LG+ IS     P  ++IQA+ +F  P+ +    RF
Sbjct: 527 FAALQTRNFVLNPPKCELLVSQINYLGHTISEKIITPMQDKIQAILNFDEPRLLSQANRF 586

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHR 528
           IG +++YR+FL N A + AP ++A+  T +   HR
Sbjct: 587 IGALSWYRKFLPNFATIAAP-IHAV--TNLTKKHR 618



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 21/47 (44%), Positives = 30/47 (63%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +DL   + QIP+   D  KTA  TPFG ++FN +  GL+N+  TFQ+
Sbjct: 443 LDLKSGFYQIPIRHADKAKTAFTTPFGHFQFNVLPMGLKNSPPTFQK 489



 Score = 33.9 bits (74), Expect = 3.7
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLL 307
           F   Y+DDI+V+S+    H  HLR +F  L+ T + ++    C +L+
Sbjct: 501 FSIVYLDDIVVFSKTYDDHLEHLRQVFAALQ-TRNFVLNPPKCELLV 546


>UniRef50_UPI00015B43C7 Cluster: PREDICTED: similar to gag-pol
           polyprotein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to gag-pol polyprotein - Nasonia vitripennis
          Length = 474

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 27/51 (52%), Positives = 38/51 (74%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           ID+ KA+ Q+P+APE+  K  I+TPFGL+EF   + GLRNA Q+ QR +D+
Sbjct: 170 IDVKKAFYQLPLAPEEAHKMVIVTPFGLFEFTKSSLGLRNAAQSLQRTVDQ 220



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/51 (45%), Positives = 28/51 (54%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           PITWTP  E+ F ACK +L+ AA       NA   L TDAS   +GA   +
Sbjct: 309 PITWTPAAEDAFVACKRALAEAASTTFLRDNARRRLLTDASDHAIGAALEQ 359



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 19/49 (38%), Positives = 29/49 (59%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLV 301
           R   F  AY+DDI+V S  A +HA HL+ LF  L+   S+ +  + C++
Sbjct: 223 RDLPFARAYLDDIIVASTSAEEHAQHLKALFDVLR-AASIKVNPDKCVL 270


>UniRef50_UPI0000F1E7B2 Cluster: PREDICTED: hypothetical protein; n=1;
            Danio rerio|Rep: PREDICTED: hypothetical protein - Danio
            rerio
          Length = 1112

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 29/85 (34%), Positives = 48/85 (56%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F+ +    + +N AKC F    +T+LG ++     +P   +I A+ +FP+P   + LRRF
Sbjct: 868  FKYLTSASLTLNLAKCEFAKGVITYLGKQVGQGLVKPVDAKITAIIEFPVPCNKRELRRF 927

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAI 498
            +GM  YYR F  N + L +PL + +
Sbjct: 928  LGMSGYYRSFCPNFSSLVSPLTDLL 952



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +DL+K + Q+P++      +A +TP    ++  + FG+RNA  TFQR +
Sbjct: 785 LDLLKGFWQVPLSQRASEISAFVTPDSFLQYKVLAFGMRNAPATFQRMM 833


>UniRef50_UPI00005848C8 Cluster: PREDICTED: similar to
           OSJNBa0059D20.6; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to OSJNBa0059D20.6 -
           Strongylocentrotus purpuratus
          Length = 1138

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 25/81 (30%), Positives = 47/81 (58%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  +    + + P KC     +V++LG+ +S+ G     E+++++K +P P+ V  +R F
Sbjct: 372 FYRLRQANLKLKPKKCFLFRKKVSYLGHEVSSKGVSTQPEKVESVKTWPTPKNVTEVRSF 431

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G+ +YYRRF+   A +  PL
Sbjct: 432 LGLASYYRRFVEGFASIAKPL 452



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 1/65 (1%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA-TIFALR 179
           T+DL   Y Q+ ++ +   K+A +   GLY +N M FGL NA  TF+R +D+  T     
Sbjct: 286 TLDLASGYWQVGLSKDAKEKSAFVADGGLYSWNVMPFGLCNAPATFERLMDKVLTGLHWE 345

Query: 180 TLTTY 194
           TL  Y
Sbjct: 346 TLLVY 350


>UniRef50_Q9SY43 Cluster: Putative reverse transcriptase; n=1;
           Arabidopsis thaliana|Rep: Putative reverse transcriptase
           - Arabidopsis thaliana (Mouse-ear cress)
          Length = 839

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 26/68 (38%), Positives = 43/68 (63%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F   E+ FLG+ +SA+G     E+I+A++D+P P     +R F+G+  YYRRF++ 
Sbjct: 603 SKCSFWQREMGFLGHIVSAEGVSVDPEKIEAIRDWPRPTNATEIRSFLGLAGYYRRFIKG 662

Query: 463 AAKLQAPL 486
            A +  P+
Sbjct: 663 FASMAQPM 670



 Score = 36.7 bits (81), Expect = 0.52
 Identities = 15/44 (34%), Positives = 27/44 (61%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           +F   ++DDILVYS+   +H  HLR + ++L+  + L  + + C
Sbjct: 563 EFVIIFIDDILVYSKSPEEHEVHLRRVMEKLR-EQKLFAKLSKC 605



 Score = 36.3 bits (80), Expect = 0.69
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 8/60 (13%)
 Frame = +3

Query: 39  VAPEDICKTAIITPFGLYEFNYMTFGLRNA--------GQTFQRFIDEATIFALRTLTTY 194
           +A  D+ KTA  T +G +EF  M FGL NA           FQ F+DE  I  +  +  Y
Sbjct: 516 LAEADVRKTAFRTRYGHFEFVVMPFGLTNAPAAFMRLMNSVFQEFLDEFVIIFIDDILVY 575



 Score = 35.9 bits (79), Expect = 0.91
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           P  W+PE EE F + K+ L+S  ++A P       ++TDAS   +G
Sbjct: 679 PFVWSPECEEGFVSLKEMLTSTPVLALPEHGEPYMVYTDASGVGLG 724


>UniRef50_Q8L7J3 Cluster: Gag-pol polyprotein; n=30;
            Magnoliophyta|Rep: Gag-pol polyprotein - Zea mays (Maize)
          Length = 1618

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 26/81 (32%), Positives = 49/81 (60%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F A+ D  +  N  KC F    V+FLG  ++  G +    +++A+  +P+P+T+  +R F
Sbjct: 895  FNALRDARLFGNLEKCTFCTDRVSFLGYVVTPQGIEVDQAKVEAIHGWPMPKTITQVRSF 954

Query: 424  IGMVNYYRRFLRNAAKLQAPL 486
            +G+  +YRRF+++ + + APL
Sbjct: 955  LGLAGFYRRFVKDFSTIAAPL 975



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 25/51 (49%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL   Y QI +   D  KTA  T FGLYE+  M FGL NA  TF R ++E
Sbjct: 810 VDLRSGYHQIRMKLGDEWKTAFKTKFGLYEWLVMPFGLTNAPSTFMRLMNE 860



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   Y DDIL+YS+   +H  H+R +F  L+
Sbjct: 869 FVVVYFDDILIYSKSMDEHVDHMRAVFNALR 899


>UniRef50_Q53P05 Cluster: Retrotransposon protein, putative,
            unclassified; n=5; Oryza sativa|Rep: Retrotransposon
            protein, putative, unclassified - Oryza sativa subsp.
            japonica (Rice)
          Length = 1126

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 24/85 (28%), Positives = 51/85 (60%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            FQ ++ + + +  +KC F   ++ +LG+ I   G      ++QA++++P+P+ ++ LR F
Sbjct: 818  FQILQHHQLFVKASKCSFAKQQLEYLGHIIGEHGVATDPAKVQAVQEWPVPKNLKQLRGF 877

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAI 498
            +G+  YYR+F+R+   +  PL   +
Sbjct: 878  LGLTGYYRKFIRHYGVITRPLTELL 902



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/57 (47%), Positives = 35/57 (61%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFAL 176
           +DL   Y +I + P+D  KTA  T  GLYEF  M FGL NA  +FQ  +++  IFAL
Sbjct: 733 LDLRSGYHKIRLLPQDEHKTAFRTHQGLYEFRVMPFGLTNAPASFQGLMNK--IFAL 787



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 15/39 (38%), Positives = 24/39 (61%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           +VDDI VYS+   +H  HLR +F+ L+    L ++ + C
Sbjct: 796 FVDDIPVYSKSLAEHVQHLRQVFQILQ-HHQLFVKASKC 833


>UniRef50_Q2R3G0 Cluster: Retrotransposon protein, putative,
            unclassified; n=1; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 1485

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 28/84 (33%), Positives = 51/84 (60%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q + D  + +  +KC F  P++ +LG+ ISA+G     ++I A++++  P +V+ LR F+
Sbjct: 836  QILSDNHLKVKQSKCSFPQPQLAYLGHVISANGVATDEDKIMAVRNWITPTSVKELRSFL 895

Query: 427  GMVNYYRRFLRNAAKLQAPLVNAI 498
             +  YYR+F+RN   +  PL N +
Sbjct: 896  RLSGYYRKFVRNYGIICKPLTNLL 919



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 23/58 (39%), Positives = 31/58 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +DL   Y QI + P+D  KTA  T  G +EF  + FGL +A  TFQ  ++      LR
Sbjct: 750 LDLRSGYHQIRMHPDDEHKTAFKTHHGDFEFRVLPFGLTSAPATFQSIMNSVLAPYLR 807


>UniRef50_Q6H8S0 Cluster: Polyprotein; n=2; Yarrowia lipolytica|Rep:
           Polyprotein - Yarrowia lipolytica (Candida lipolytica)
          Length = 1240

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 27/71 (38%), Positives = 47/71 (66%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC     ++ FLG+ +SA G +P  E+++ ++++  P T +GL  F+G+  YYRRF+ +
Sbjct: 492 SKCELFRKKMGFLGHVVSAAGVEPDPEKVKVVEEWVPPNTPKGLLSFLGLTGYYRRFIED 551

Query: 463 AAKLQAPLVNA 495
            AK+ APL +A
Sbjct: 552 YAKIAAPLTDA 562



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 27/63 (42%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = +3

Query: 9   DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA-TIFALRTL 185
           DL+  Y Q+ V   D+ KTA  T  G YE+  M FGL NA  TFQR +++A   F  +T+
Sbjct: 395 DLLSGYWQVLVKESDVHKTAFSTRSGHYEYLVMPFGLCNAPATFQRLMNDALRPFLNKTV 454

Query: 186 TTY 194
             Y
Sbjct: 455 CVY 457


>UniRef50_Q5QQL8 Cluster: Pol protein; n=1; Orpinomyces sp.
           OUS1|Rep: Pol protein - Orpinomyces sp. OUS1
          Length = 802

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 26/76 (34%), Positives = 47/76 (61%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           D G+     KC F   E TFLG  +S +G      +++++ ++P P+ ++ L+ F+G+ N
Sbjct: 332 DNGLYAKLEKCDFHVAETTFLGFTVSINGLTMDQNKVKSVVEWPTPKNLKELQSFLGLCN 391

Query: 439 YYRRFLRNAAKLQAPL 486
           +YR+F++N AK+  PL
Sbjct: 392 FYRKFIKNFAKIMEPL 407



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 24/51 (47%), Positives = 28/51 (54%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL  AY  + V       TA  TP G YE+  M FGLRNA   FQRFI +
Sbjct: 242 LDLRSAYNLVRVKAGHEYLTAFRTPIGHYEYLVMPFGLRNAPSVFQRFIQD 292


>UniRef50_Q15F62 Cluster: Pol polyprotein; n=1; Nosema bombycis|Rep:
           Pol polyprotein - Nosema bombycis
          Length = 1238

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 27/77 (35%), Positives = 47/77 (61%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           I++ G+V+   KC F   E+  LGN +S    +P   +I  ++ +P P T++ LR F+G+
Sbjct: 645 IKENGVVLKKKKCSFFKDEIKILGNIVSKGYFKPDPAKIDTIQKYPFPDTLKSLRSFLGL 704

Query: 433 VNYYRRFLRNAAKLQAP 483
           VNY R ++ + A+L +P
Sbjct: 705 VNYCREYVASYAELTSP 721



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/51 (49%), Positives = 29/51 (56%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    Y QI +   D  KTA     GLYE+N M FGL NA  TFQR +D
Sbjct: 556 TLDATSGYYQIGMNESDKQKTAFAWKGGLYEYNRMPFGLCNAPATFQRAMD 606



 Score = 33.1 bits (72), Expect = 6.4
 Identities = 12/44 (27%), Positives = 25/44 (56%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           +F   Y+DDI+++S+    H  HL  +  R+K    +++++  C
Sbjct: 615 EFVIPYLDDIIIFSKSEKDHGQHLLDVLSRIK-ENGVVLKKKKC 657


>UniRef50_UPI00015B43E0 Cluster: PREDICTED: similar to protease,
           reverse transcriptase and RNase H, partial; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to protease, reverse
           transcriptase and RNase H, partial - Nasonia vitripennis
          Length = 480

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 27/83 (32%), Positives = 53/83 (63%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           ++ + ++ + +N  K  F   E+ FLG+ ISA G +P  E+I+ +++F  P+ ++ L+ F
Sbjct: 352 YERLIEHNLRLNFIKSKFFCEEIEFLGHYISAKGIRPDPEKIRTIRNFKRPKNLKQLQSF 411

Query: 424 IGMVNYYRRFLRNAAKLQAPLVN 492
           IG +N+Y +F ++ A+   PL+N
Sbjct: 412 IGFINFYSKFTKHFAESLIPLLN 434


>UniRef50_UPI0000E491A5 Cluster: PREDICTED: similar to transposase;
            n=6; Strongylocentrotus purpuratus|Rep: PREDICTED:
            similar to transposase - Strongylocentrotus purpuratus
          Length = 1612

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 27/73 (36%), Positives = 45/73 (61%)
 Frame = +1

Query: 268  IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
            I +N +K  +   EV F+G+R++ +G +P   ++ AL D P P  + G++RF+GMV Y  
Sbjct: 891  IKLNSSKLEYKCKEVQFIGHRLTKEGVRPDPSKVAALVDMPQPVDIPGIQRFVGMVQYLA 950

Query: 448  RFLRNAAKLQAPL 486
            +FL + + L  PL
Sbjct: 951  KFLPSLSGLSEPL 963



 Score = 32.7 bits (71), Expect = 8.4
 Identities = 16/50 (32%), Positives = 27/50 (54%)
 Frame = +3

Query: 9   DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           DL + + Q  +  E    T+  TP+G Y F  + FGL  + + FQ+ +D+
Sbjct: 795 DLKEGFLQCKLDAESSKLTSFQTPWGRYRFLRLPFGLSPSPELFQKRLDQ 844


>UniRef50_Q6L4N0 Cluster: Putative uncharacterized protein
           P0530H10.3; n=2; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           P0530H10.3 - Oryza sativa subsp. japonica (Rice)
          Length = 903

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 31/89 (34%), Positives = 54/89 (60%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q  ++  +V+N  KC F   E   LG++IS  G +    +I+ ++  P P  V+G+R F+
Sbjct: 447 QRCQEKDLVLNWEKCHFMVREGIVLGHQISERGVEVDRAKIEVIRQLPPPVNVKGVRSFL 506

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAIVATEV 513
           G V +YRRF+++ +K+  PL  A++A +V
Sbjct: 507 GHVGFYRRFIKDFSKIARPL-TALLAKDV 534


>UniRef50_Q53JQ7 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            sub-class; n=4; Oryza sativa|Rep: Retrotransposon
            protein, putative, Ty3-gypsy sub-class - Oryza sativa
            subsp. japonica (Rice)
          Length = 1567

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 30/86 (34%), Positives = 47/86 (54%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            + ++ +    +KC F   EV FLG+ ISA G     E   A+ D+  P+TV  +R F+G+
Sbjct: 1077 LREHQLYAKLSKCEFWLSEVKFLGHVISAKGVAVDPETATAVTDWKQPKTVTQIRSFLGL 1136

Query: 433  VNYYRRFLRNAAKLQAPLVNAIVATE 510
              YYRRF+ N +K+  P+   +   E
Sbjct: 1137 AGYYRRFIENFSKIARPMTQLLKKEE 1162



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            IDL   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 989  IDLRSGYHQLRIREEDIPKTAFTTRYGLYEFTVMSFGLTNAPAFFMNLMNK 1039


>UniRef50_Q2QSH9 Cluster: Retrotransposon protein, putative,
            unclassified, expressed; n=10; Oryza sativa|Rep:
            Retrotransposon protein, putative, unclassified,
            expressed - Oryza sativa subsp. japonica (Rice)
          Length = 1548

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 27/80 (33%), Positives = 48/80 (60%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q ++ + +    +KC F AP++ +LG+ ISA G    +E+ + +  +P+P  +  LR F+
Sbjct: 797  QLLQQHQLCAKLSKCSFAAPQLEYLGHIISAAGVATDAEKTKVMLQWPVPTNLTELRGFL 856

Query: 427  GMVNYYRRFLRNAAKLQAPL 486
            G+  YYR+F++N   L  PL
Sbjct: 857  GLTGYYRKFVKNYGILAKPL 876



 Score = 41.1 bits (92), Expect = 0.024
 Identities = 24/56 (42%), Positives = 31/56 (55%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFA 173
           +DL   Y QI +   D  KTA  T  G ++F  M FGL NA  TFQ  ++  +IFA
Sbjct: 711 LDLRSGYHQIRMQESDEFKTAFKTHHGHFQFRVMPFGLTNAPATFQCLMN--SIFA 764


>UniRef50_UPI00015B47AD Cluster: PREDICTED: similar to gag-pol
           polyprotein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to gag-pol polyprotein - Nasonia vitripennis
          Length = 522

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 29/50 (58%), Positives = 36/50 (72%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           IDL KA+ Q+P+APED  KTAIIT FGL+EF   + GLRN  Q+ Q  +D
Sbjct: 375 IDLKKAFYQVPIAPEDAHKTAIITTFGLFEFARSSMGLRNTAQSLQHAMD 424



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 27/65 (41%), Positives = 36/65 (55%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  +    I IN  KC     EV +LG  IS DG  PP  +++A++ FP P     LRRF
Sbjct: 458 FATLRKAHIKINQDKCTLTKKEVIYLGYHISNDGCTPPPGKVEAIQSFPQPADTSQLRRF 517

Query: 424 IGMVN 438
           +G+VN
Sbjct: 518 LGLVN 522


>UniRef50_UPI0000F1FACA Cluster: PREDICTED: similar to pol
           polyprotein; n=2; Danio rerio|Rep: PREDICTED: similar to
           pol polyprotein - Danio rerio
          Length = 579

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 27/73 (36%), Positives = 45/73 (61%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           + + P KC F   +V FLG  I     Q   +++QA+ D+P P +V+ ++RF+G  N+YR
Sbjct: 167 LYVKPEKCQFHVSQVKFLGFVIQPGQIQMDPQKVQAMADWPSPSSVKEVQRFLGFANFYR 226

Query: 448 RFLRNAAKLQAPL 486
           +F+ N + + APL
Sbjct: 227 KFILNFSTVVAPL 239



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 22/51 (43%), Positives = 28/51 (54%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL  AY  + +   D  KTA  TP G YE+  M FGL NA   FQ  I++
Sbjct: 74  LDLRNAYHLVRIKRGDEWKTAFNTPTGHYEYLVMPFGLTNAPAVFQALIND 124



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 15/43 (34%), Positives = 24/43 (55%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           F F Y+DDIL++S    +H  H+R +  RL +   L ++   C
Sbjct: 133 FVFVYLDDILIFSSSLQEHVHHVRKVLHRL-LENHLYVKPEKC 174



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 16/48 (33%), Positives = 25/48 (52%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           W PE E+ FN  K   +SA ++  P P+    +  DAS   +GA  ++
Sbjct: 252 WGPEAEKAFNELKKRFTSAPILLIPNPDKPFTVEVDASEVGIGAVLSQ 299


>UniRef50_UPI0000F1E5A7 Cluster: PREDICTED: similar to pol
           polyprotein; n=1; Danio rerio|Rep: PREDICTED: similar to
           pol polyprotein - Danio rerio
          Length = 1047

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 26/81 (32%), Positives = 48/81 (59%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  + ++G+ + P+KC     EV +LG+ +SA+G +   E+I  +KD+  P     + +F
Sbjct: 153 FDRLREHGLKLKPSKCQLVRKEVQYLGHLVSAEGIRTDPEKINKVKDWQRPTNCVEVLQF 212

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G   YYRR+++  + L +PL
Sbjct: 213 LGFTGYYRRYVKGYSNLVSPL 233



 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 27/50 (54%), Positives = 33/50 (66%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           T+DL   Y Q+ VA +D  KTA  TP GL+E N M FGL+NA  TFQR +
Sbjct: 68  TLDLTSGYWQVEVAEQDKPKTAFSTPMGLFEANRMPFGLQNAPSTFQRLM 117



 Score = 37.1 bits (82), Expect = 0.39
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           P  WT E EE F + K+ L S  ++ +P  +    L TDAS + +GA
Sbjct: 257 PFLWTAECEEAFQSLKEKLISVPVLGYPDYSQPFLLQTDASGTGLGA 303


>UniRef50_UPI0000E49332 Cluster: PREDICTED: similar to
           OSJNBa0011F23.1; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to OSJNBa0011F23.1 -
           Strongylocentrotus purpuratus
          Length = 1261

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 29/85 (34%), Positives = 50/85 (58%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  +  YG+ +   KC F   E+T LG+ +S  G    + +++ + ++P P+T   L+ F
Sbjct: 550 FDRLIKYGLKLRGEKCQFLRKELTHLGHIVSDKGVMVDTRKVERVANWPTPKTSSELQSF 609

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+ +YYRRF+   AK+ APL + I
Sbjct: 610 LGLASYYRRFVPYFAKIAAPLHSLI 634



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           ++DL   Y Q+ + P+ +  TA   P+GL++F  M  GL N+  TFQR ++
Sbjct: 464 SLDLTHGYYQVAMHPDSVPLTAFRVPWGLFDFERMPQGLCNSPCTFQRIME 514



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/71 (32%), Positives = 38/71 (53%)
 Frame = +3

Query: 465 GQVTSTASQRDRGH*GKGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDA 644
           G+ +S A +R   +  +  T   WT E +E F   K+SL++  ++A+P    E  L  DA
Sbjct: 636 GKTSSKAGKRHPRNTCQDDTKFKWTEEADESFQVLKNSLTTTPVLAYPRFGEEFTLEVDA 695

Query: 645 SSSHVGACFNR 677
           S   +GAC ++
Sbjct: 696 SLKGLGACLSQ 706


>UniRef50_Q7XWZ0 Cluster: OSJNBb0072N21.12 protein; n=1; Oryza
           sativa (japonica cultivar-group)|Rep: OSJNBb0072N21.12
           protein - Oryza sativa subsp. japonica (Rice)
          Length = 1239

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 26/81 (32%), Positives = 48/81 (59%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F A+ D  +  N  KC F    V+FLG  ++  G +    +++A+  +P+P T+  +R F
Sbjct: 698 FDALRDARLFGNLEKCTFCTDRVSFLGYVVTPQGIEVDQAKVEAIHSWPVPTTITQVRSF 757

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G+  +YRRF+++ + + APL
Sbjct: 758 LGLAGFYRRFVKDFSTIAAPL 778



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 25/51 (49%), Positives = 29/51 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y QI +   D  KTA  T F LYE+  M FGL NA  TF R ++E
Sbjct: 613 IDLRSGYHQIRMKLGDEWKTAFKTKFSLYEWLVMPFGLTNAPSTFMRLMNE 663



 Score = 33.1 bits (72), Expect = 6.4
 Identities = 14/31 (45%), Positives = 17/31 (54%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   Y D IL+YSR    H  HLR +F  L+
Sbjct: 672 FVVVYFDGILIYSRSIEDHHGHLRAVFDALR 702


>UniRef50_Q2R264 Cluster: Retrotransposon protein, putative,
            unclassified; n=1; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 940

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 33/114 (28%), Positives = 61/114 (53%), Gaps = 4/114 (3%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q + ++ + +  +KC F    +T+LG+ ISA G     + I+A++ + +P  V+ ++ F+
Sbjct: 766  QLLSEHQLKVKRSKCSFARSSLTYLGHVISASGVATDPKNIKAVQAWAIPVNVKEVQGFL 825

Query: 427  GMVNYYRRFLRNAAKLQAPLVNAIVATEVKV----SHRSLGHLSSKNALMPVKI 576
            G+V YYR+F+R+   +  PL N +    V V     H +   L +   L PV +
Sbjct: 826  GLVGYYRKFVRSFGIISRPLTNLLKKNVVFVWTSEHHTAFDALKAALTLAPVLV 879



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 24/52 (46%), Positives = 31/52 (59%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           ++DL   Y QI + PED  KTA  T  G YEF  M+FGL  A  TFQ  +++
Sbjct: 695 SLDLRAGYHQIRMRPEDEHKTAFKTHNGHYEFRVMSFGLIGALATFQGIMNQ 746


>UniRef50_Q2QPU3 Cluster: Retrotransposon protein, putative,
           unclassified; n=4; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           unclassified - Oryza sativa subsp. japonica (Rice)
          Length = 1269

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 27/85 (31%), Positives = 51/85 (60%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ + D+ + +  +KC F    + +LG+ ISA+G    S+ IQA+ ++ +P  V+ +R F
Sbjct: 631 FQLLTDHQLKVKRSKCSFARASLPYLGHVISAEGVATDSKNIQAVHNWAVPCNVKEVRGF 690

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+  YYR+F+ +   +  PL + +
Sbjct: 691 LGLAGYYRKFVHSFGIISRPLTDLL 715



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 25/59 (42%), Positives = 33/59 (55%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           + DL   Y QI + PED  KTA  T  G YEF  M++GL +A  TFQ  +++     LR
Sbjct: 545 SFDLRAGYHQIRMRPEDEHKTAFKTHNGHYEFRVMSYGLTSAPATFQVLMNQILAPLLR 603



 Score = 33.1 bits (72), Expect = 6.4
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           WT E +  F+A K++L SA ++A P  +    + TDAS   VGA
Sbjct: 723 WTSEHQASFDALKEALVSAPVLALPDFSKVFEIETDASDKGVGA 766


>UniRef50_O81490 Cluster: F9D12.11 protein; n=4; Arabidopsis
           thaliana|Rep: F9D12.11 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 1322

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 26/68 (38%), Positives = 43/68 (63%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F   E+ FLG+ +SA+G     E+I+A++D+P P     +R F+G+  YYRRF++ 
Sbjct: 710 SKCSFWQREMGFLGHIVSAEGVSVDPEKIEAIRDWPRPTNAVEIRSFLGLAGYYRRFVKG 769

Query: 463 AAKLQAPL 486
            A +  P+
Sbjct: 770 FASMAQPM 777



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 29/71 (40%), Positives = 36/71 (50%), Gaps = 8/71 (11%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNA--------GQTFQRFIDEA 161
           IDL   Y QIP+A  D+ KTA  T +G +EF  M FGL NA           FQ F+DE 
Sbjct: 612 IDLTSDYHQIPIAEADVRKTAFRTRYGHFEFVVMPFGLTNAPAAFMRLMNSVFQEFLDEF 671

Query: 162 TIFALRTLTTY 194
            I  +  +  Y
Sbjct: 672 VIIFIDDILVY 682



 Score = 37.1 bits (82), Expect = 0.39
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           P  W+PE EE F + K+ L+S  ++A P       ++TDAS   +G
Sbjct: 786 PFVWSPECEEGFVSLKEMLTSTPVLALPEHGEPYSVYTDASGVGLG 831



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 15/44 (34%), Positives = 27/44 (61%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           +F   ++DDILVYS+   +H  HLR + ++L+  + L  + + C
Sbjct: 670 EFVIIFIDDILVYSKSPEEHEVHLRRVKEKLR-EQKLFAKLSKC 712


>UniRef50_A5C623 Cluster: Putative uncharacterized protein; n=5;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1694

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 28/78 (35%), Positives = 47/78 (60%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           +V+N  KC F  P+   LG+ IS  G +    +++ +   P P TV+G+R+F+G   +YR
Sbjct: 673 LVLNWEKCHFMVPQGIILGHIISNQGIEVDKAKVELIVKLPSPTTVKGVRQFLGHAGFYR 732

Query: 448 RFLRNAAKLQAPLVNAIV 501
           RF+++ +KL  PL   +V
Sbjct: 733 RFIKDFSKLXRPLCELLV 750


>UniRef50_Q24310 Cluster: Polyprotein; n=1; Drosophila
           melanogaster|Rep: Polyprotein - Drosophila melanogaster
           (Fruit fly)
          Length = 1053

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 29/74 (39%), Positives = 43/74 (58%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G   N AKC F    V +LG  + A   +P   +I +L   P PQTV G+R+FIG+ +Y+
Sbjct: 627 GFTFNLAKCSFLKTTVQYLGYEVRAGEIRPNVRKIASLSSLPPPQTVSGVRQFIGLASYF 686

Query: 445 RRFLRNAAKLQAPL 486
           R+F+   ++L  PL
Sbjct: 687 RKFVSGFSQLMKPL 700


>UniRef50_Q9UVD8 Cluster: Pol; n=1; Alternaria alternata|Rep: Pol -
           Alternaria alternata (Alternaria rot fungus)
          Length = 1265

 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 28/79 (35%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISAD-GTQPPSERIQALKDFPLPQTVQGLRRFIG 429
           ++D G+ ++  KC F      +LG  I A  G      ++ A++++  PQTV+G+R F+G
Sbjct: 438 LQDAGLQVDIKKCEFEVKSTKYLGFIIKAGKGISMDPAKVAAIREWEAPQTVKGVRSFLG 497

Query: 430 MVNYYRRFLRNAAKLQAPL 486
             N+YR+F++N ++L APL
Sbjct: 498 FANFYRKFIKNFSQLAAPL 516



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 22/50 (44%), Positives = 33/50 (66%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +D++ A+ +I VA  D  KTA  T FGL+E+    FG+ N+  TFQR+I+
Sbjct: 349 LDVIAAFHKIRVAEGDEWKTAFRTRFGLFEWLVTPFGMANSPSTFQRYIN 398



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 15/33 (45%), Positives = 25/33 (75%), Gaps = 1/33 (3%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDAL-QHAAHLRTLFKRLK 259
           DFC AY+DD+L+Y+  +L QH  H+R + ++L+
Sbjct: 407 DFCSAYLDDVLIYTDGSLKQHQEHVRKVLRKLQ 439


>UniRef50_UPI00015B4834 Cluster: PREDICTED: similar to gag-pol
           polyprotein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to gag-pol polyprotein - Nasonia vitripennis
          Length = 644

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 34/85 (40%), Positives = 49/85 (57%), Gaps = 1/85 (1%)
 Frame = +1

Query: 274 INPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRF 453
           IN  KC     +VT+LG  ISA+G +P + +I+A++ +P P       RF+G+VNYYR  
Sbjct: 439 INQDKCTLAKNKVTYLGYIISAEGCKPLTGKIEAIQAYPQPADSSQRCRFLGLVNYYRCC 498

Query: 454 LRNAAKLQAPLVNAIV-ATEVKVSH 525
           +   A L  PL + +  A E  VSH
Sbjct: 499 IPRTADLLTPLNDMLTSAKETLVSH 523



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 23/38 (60%), Positives = 28/38 (73%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGL 119
           IDL KA+ Q+P+APED  KTAIITPFG Y+    + GL
Sbjct: 396 IDLKKAFYQLPIAPEDAHKTAIITPFGFYKLTRSSMGL 433


>UniRef50_UPI00015B472B Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 2069

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 30/83 (36%), Positives = 51/83 (61%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           +V+ P K  F   EV FLG+ IS+ G +P  E+++A+     P+T + +R  +GM  YYR
Sbjct: 664 LVLQPDKIEFFRREVGFLGHIISSRGIEPNPEKVEAITKLLTPKTAKNVRTLLGMFGYYR 723

Query: 448 RFLRNAAKLQAPLVNAIVATEVK 516
           +++++ AK+  PL N ++   VK
Sbjct: 724 KYIKDFAKIAKPL-NDLLKKNVK 745



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/51 (50%), Positives = 34/51 (66%)
 Frame = +3

Query: 9   DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           DL   +QQIP+APED  KTA  T  G YE+  +  GL+NA  TFQR +++A
Sbjct: 572 DLASGFQQIPMAPEDCYKTAFTTLDGHYEYTRLPEGLKNAIATFQRLMEKA 622



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 13/33 (39%), Positives = 23/33 (69%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLL 277
           Y+DDI+VYS+D  +H   +R +  RL++ + +L
Sbjct: 634 YLDDIIVYSKDLQEHEQRIRHMMDRLRLAKLVL 666


>UniRef50_A5X2S4 Cluster: Polyprotein; n=3; Spermatophyta|Rep:
           Polyprotein - Primula vulgaris
          Length = 1359

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 25/60 (41%), Positives = 42/60 (70%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F   E+ +LG+ IS  G +    +I+A+ ++P+P+ ++GLR F+G+  YYRRF+RN
Sbjct: 675 SKCKFFQKEIDYLGHLISDQGVKADPNKIKAMLEWPVPKNLKGLRGFLGLTGYYRRFIRN 734



 Score = 38.7 bits (86), Expect = 0.13
 Identities = 21/46 (45%), Positives = 24/46 (52%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQ 143
           +DL   Y QI +   D+ KTA  T  G YEF  M   L NA  TFQ
Sbjct: 577 LDLRSGYHQIKMHANDVSKTAFRTHEGQYEFLVMPLVLTNAPATFQ 622



 Score = 32.7 bits (71), Expect = 8.4
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRL 256
           + C  + DDILVYS+   +H  HL  + K++
Sbjct: 635 NLCLFFFDDILVYSKTNDEHICHLEAVLKKM 665


>UniRef50_A5C6S0 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 499

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 27/86 (31%), Positives = 47/86 (54%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           +F+ +  +   I   KC F   EV +LG  ++    +    +I+A+ ++P P  V  LR 
Sbjct: 157 AFEILRHHKFFIKLGKCAFDQQEVEYLGYVVTPQSVKVDQGKIKAMLNWPRPTNVSDLRG 216

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAI 498
           F+G++ YYR+F+RN   +  PL N +
Sbjct: 217 FLGLIGYYRKFVRNYGVIARPLTNLL 242


>UniRef50_A5C356 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1078

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 27/86 (31%), Positives = 48/86 (55%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           +F+ +  +   I   KC FG  +V +LG+ ++  G +    +I+A+ ++P    V  LR 
Sbjct: 516 AFEILRHHKFFIKLGKCAFGQQZVEYLGHIVTPQGVKVDQGKIKAMLNWPRLTNVSDLRG 575

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAI 498
           F+G+  YYR+F+RN   +  PL N +
Sbjct: 576 FLGLTGYYRKFVRNYGVIAWPLTNXL 601



 Score = 33.1 bits (72), Expect = 6.4
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W  E E+ F A K +++S   +A P  N    +  DASS+ +GA
Sbjct: 608 WXEEAEBAFKALKQAMTSIPTLAMPNFNEPFXIEXDASSAGIGA 651


>UniRef50_Q05654 Cluster: Retrotransposable element Tf2 155 kDa
           protein type 1; n=7; Schizosaccharomyces pombe|Rep:
           Retrotransposable element Tf2 155 kDa protein type 1 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 1333

 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 30/84 (35%), Positives = 48/84 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  ++IN AKC F   +V F+G  IS  G  P  E I  +  +  P+  + LR+F+
Sbjct: 587 QKLKNANLIINQAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFL 646

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G VNY R+F+   ++L  PL N +
Sbjct: 647 GSVNYLRKFIPKTSQLTHPLNNLL 670



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 14/39 (35%), Positives = 26/39 (66%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y+DDIL++S+   +H  H++ + ++LK   +L+I Q  C
Sbjct: 564 YMDDILIHSKSESEHVKHVKDVLQKLK-NANLIINQAKC 601


>UniRef50_UPI00015B48E9 Cluster: PREDICTED: similar to
           OSJNBa0042F21.10; n=3; Nasonia vitripennis|Rep:
           PREDICTED: similar to OSJNBa0042F21.10 - Nasonia
           vitripennis
          Length = 724

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 26/71 (36%), Positives = 43/71 (60%)
 Frame = +1

Query: 286 KCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNA 465
           KC F   EV +LG+ IS  G +P   +I+A+K++P P+  + +++F+  V YYRRF+   
Sbjct: 327 KCEFLKKEVAYLGHIISEAGVKPDPRKIEAVKEYPAPRNKKNIKQFLDFVGYYRRFIDKF 386

Query: 466 AKLQAPLVNAI 498
           A +  PL   +
Sbjct: 387 ANIAVPLTEML 397


>UniRef50_UPI00015B4589 Cluster: PREDICTED: similar to protease,
           reverse transcriptase, ribonuclease H, integrase; n=1;
           Nasonia vitripennis|Rep: PREDICTED: similar to protease,
           reverse transcriptase, ribonuclease H, integrase -
           Nasonia vitripennis
          Length = 807

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 25/77 (32%), Positives = 50/77 (64%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           + +N  KC F    V +LG  I+ +G +  +E++  ++++P P+T++ +RRFIGM ++YR
Sbjct: 142 LTLNRDKCEFCCASVRYLGFVINEEGLKIDTEKVAPIRNYPPPKTLRQVRRFIGMASWYR 201

Query: 448 RFLRNAAKLQAPLVNAI 498
           RF+++ A +  P+   +
Sbjct: 202 RFIKDFATITEPITRLL 218



 Score = 39.9 bits (89), Expect = 0.056
 Identities = 25/52 (48%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPF-GLYEFNYMTFGLRNAGQTFQRFID 155
           TIDL +AY QI    +    TA I P  GLY F  + FGL  A  TFQR  D
Sbjct: 47  TIDLKQAYFQILFEEKSREITAFIVPGRGLYHFKRLCFGLSGAPSTFQRLQD 98


>UniRef50_UPI00015B443A Cluster: PREDICTED: similar to protease,
            reverse transcriptase, ribonuclease H, integrase; n=2;
            Nasonia vitripennis|Rep: PREDICTED: similar to protease,
            reverse transcriptase, ribonuclease H, integrase -
            Nasonia vitripennis
          Length = 1702

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 26/77 (33%), Positives = 50/77 (64%)
 Frame = +1

Query: 268  IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
            + +N  KC F    V +LG  I+ +G +  +E++  ++++P P+T++ +RRFIGM ++YR
Sbjct: 906  LTLNRDKCEFCCASVRYLGFVINEEGLKIDTEKVAPIRNYPPPKTLRQVRRFIGMSSWYR 965

Query: 448  RFLRNAAKLQAPLVNAI 498
            RF+++ A +  PL   +
Sbjct: 966  RFIKDFATITEPLTRLL 982



 Score = 39.5 bits (88), Expect = 0.074
 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPF-GLYEFNYMTFGLRNAGQTFQRFIDE 158
           TIDL +AY QI +  +    TA I P  GL+ F  + FGL  A  TFQR  D+
Sbjct: 811 TIDLKQAYFQILLEEKSREITAFIVPGRGLFHFKRLCFGLSGAPSTFQRLQDK 863


>UniRef50_UPI00015B4386 Cluster: PREDICTED: hypothetical protein;
           n=2; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 997

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 30/90 (33%), Positives = 52/90 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q + +  +V+ P K  F   EV FLG+  SA G +P  E++ A+     P++ + +R  +
Sbjct: 297 QRLREAKLVLQPDKIEFFRNEVGFLGHITSARGVEPNPEKVAAIAKLATPKSAKNIREVL 356

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAIVATEVK 516
           GM  YYR+++++ AK+  PL N ++   VK
Sbjct: 357 GMFGYYRKYIKDFAKIAKPL-NDLLKKNVK 385



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 23/50 (46%), Positives = 31/50 (62%)
 Frame = +3

Query: 9   DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           DL   + QIP+APED  KTA  T    YE+  M+ GL+NA   FQR +++
Sbjct: 212 DLASGFHQIPMAPEDCYKTAFTTINRHYEYTRMSEGLKNATANFQRLMEK 261



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 14/33 (42%), Positives = 23/33 (69%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLL 277
           Y+DDI+VYS+D  +H   +R L +RL+  + +L
Sbjct: 274 YLDDIIVYSKDLQEHENRIRNLMQRLREAKLVL 306


>UniRef50_Q7XWU5 Cluster: OSJNBa0065B15.6 protein; n=1; Oryza sativa
            (japonica cultivar-group)|Rep: OSJNBa0065B15.6 protein -
            Oryza sativa subsp. japonica (Rice)
          Length = 1467

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 26/86 (30%), Positives = 49/86 (56%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            + + + ++ +    +KC F   EV FLG+ ISA G       ++++ ++  P+TV  +R 
Sbjct: 871  ALEKLREHQLYAKFSKCEFWLSEVKFLGHVISAGGVAVDPSNVESVTNWKQPKTVSEIRN 930

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAI 498
            F+G+  YYRRF+ N +K+  P+   +
Sbjct: 931  FLGLAGYYRRFIENFSKIAKPMTRLL 956



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GL+E   M+FGL NA   F   +++
Sbjct: 787 IDLRSGYHQLRIKEEDIPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNK 837


>UniRef50_Q53K71 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 836

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 27/72 (37%), Positives = 44/72 (61%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F  PEV FLG+ ISA G       ++++ ++  P+TV  +R F+G+  YYRRF+ N
Sbjct: 596 SKCEFWLPEVKFLGHVISAGGVAVDPSNVESVLNWKQPKTVSEIRSFLGLAWYYRRFIEN 655

Query: 463 AAKLQAPLVNAI 498
            +K+  P+   +
Sbjct: 656 FSKIARPMTRLL 667



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GL+E   M+FGL NA   F   +++
Sbjct: 498 IDLRSGYHQLRIREEDIPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNK 548



 Score = 33.1 bits (72), Expect = 6.4
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YS+   +H  HLR    +L+
Sbjct: 546 MNKMFMEYLDKFVVVFIDDILIYSKTKEEHEEHLRLALGKLR 587


>UniRef50_Q339J2 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            subclass; n=5; Oryza sativa|Rep: Retrotransposon protein,
            putative, Ty3-gypsy subclass - Oryza sativa subsp.
            japonica (Rice)
          Length = 1392

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 26/81 (32%), Positives = 48/81 (59%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F A+ D  +  N  KC F    V+FLG  ++  G +    +++A+  +P+P T+  +R F
Sbjct: 769  FDALRDARLFGNLEKCTFCIDRVSFLGYVVTPQGIEVDQAKVEAIHSWPVPTTITQVRSF 828

Query: 424  IGMVNYYRRFLRNAAKLQAPL 486
            +G+  +YRRF+++ + + APL
Sbjct: 829  LGVAGFYRRFVKDFSTIAAPL 849



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/51 (49%), Positives = 29/51 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y QI +   D  K A  T FGLYE+  M FGL NA  TF R ++E
Sbjct: 684 IDLRSGYHQIRMKLGDEWKAAFKTKFGLYEWLVMPFGLTNAPSTFMRLMNE 734



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 15/31 (48%), Positives = 17/31 (54%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   Y DDIL YSR    H  HLR +F  L+
Sbjct: 743 FVVVYFDDILTYSRSIEDHHGHLRAVFDALR 773


>UniRef50_Q2R8S5 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            subclass; n=7; Magnoliophyta|Rep: Retrotransposon
            protein, putative, Ty3-gypsy subclass - Oryza sativa
            subsp. japonica (Rice)
          Length = 1529

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 26/86 (30%), Positives = 49/86 (56%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            + + + ++ +    +KC F   EV FLG+ ISA G       ++++ ++  P+TV  +R 
Sbjct: 826  ALEKLREHQLYAKFSKCEFWLSEVKFLGHVISAGGVAVDPSNVESVTNWKQPKTVSEIRN 885

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAI 498
            F+G+  YYRRF+ N +K+  P+   +
Sbjct: 886  FLGLAGYYRRFIENFSKIAKPMTRLL 911


>UniRef50_Q2R634 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            subclass; n=3; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            Ty3-gypsy subclass - Oryza sativa subsp. japonica (Rice)
          Length = 1431

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 28/82 (34%), Positives = 47/82 (57%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            + ++ +    +KC F   E+ FLG+ ISA G     E + A+ D+  P+TV  +R F+G+
Sbjct: 790  LREHQLYAKLSKCEFWLSEMKFLGHVISAKGVAVDPETVIAVTDWKQPKTVTQVRSFLGL 849

Query: 433  VNYYRRFLRNAAKLQAPLVNAI 498
              YYRRF+ N +K+  P+   +
Sbjct: 850  AGYYRRFIENFSKIARPMTQLL 871



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 702 IDLRSGYHQLRIREEDIPKTAFTTRYGLYEFIVMSFGLTNAPAFFMNLMNK 752


>UniRef50_A5C120 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 771

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 27/74 (36%), Positives = 47/74 (63%)
 Frame = +1

Query: 277 NPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFL 456
           N  KC F   +V FLG  +SA G +   E+++A+K++P P+ +  +R F G+ ++YRRF+
Sbjct: 290 NLKKCSFCMDKVVFLGYVVSAKGIEVDEEKVKAIKEWPTPKLITEVRSFHGLASFYRRFV 349

Query: 457 RNAAKLQAPLVNAI 498
           ++ + L APL   +
Sbjct: 350 KDFSILAAPLTEIV 363



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 24/52 (46%), Positives = 29/52 (55%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           IDL   Y QI +   D  KT   T +GLYE+  M FGL NA  TF R ++ A
Sbjct: 194 IDLKSGYHQIRMKEGDEWKTTFKTKYGLYEWLVMPFGLTNAPSTFMRLMNHA 245


>UniRef50_Q94885 Cluster: Orf protein; n=1; Drosophila
            melanogaster|Rep: Orf protein - Drosophila melanogaster
            (Fruit fly)
          Length = 1494

 Score = 62.9 bits (146), Expect = 7e-09
 Identities = 26/81 (32%), Positives = 50/81 (61%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F+ + +  + +   KC F    + +LG  I+ DG  P  + I+A+K+FP+P  V  ++ F
Sbjct: 891  FKRLVENKLELRIDKCEFMQSSIKYLGFIINKDGIMPNDKGIEAIKNFPIPNNVHTVQSF 950

Query: 424  IGMVNYYRRFLRNAAKLQAPL 486
            +G+ +Y+RRF+++ ++L  PL
Sbjct: 951  LGLCSYFRRFIKDFSRLAKPL 971



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/56 (42%), Positives = 34/56 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFA 173
           +DL   +  + V  E I  T+ +TP G YE+  M FGL+NA   FQRF+++  IFA
Sbjct: 805 LDLKNGFFHVHVKKESIKYTSFVTPLGQYEWLRMPFGLKNAPSVFQRFVNK--IFA 858


>UniRef50_Q9ZS84 Cluster: Polyprotein; n=1; Solanum lycopersicum|Rep:
            Polyprotein - Solanum lycopersicum (Tomato) (Lycopersicon
            esculentum)
          Length = 1542

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 26/82 (31%), Positives = 48/82 (58%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            +  Y + +   KC F   E+ FLG+ +S +  +   +++QA+ D+  P+ V+ LR F+G+
Sbjct: 789  LRKYTLYVKMEKCEFAQQEIKFLGHLVSKNQVRMDPKKVQAIVDWQAPRHVKDLRSFLGL 848

Query: 433  VNYYRRFLRNAAKLQAPLVNAI 498
             NYYR+F+   +K  A L + +
Sbjct: 849  ANYYRKFIAGYSKKAASLTDLL 870



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 21/45 (46%), Positives = 26/45 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTF 140
           +DL   Y Q+ +A  D  KT  +T +G YEF  M FGL NA  TF
Sbjct: 701 LDLRAGYWQVRIAEGDEPKTTCVTRYGSYEFLVMPFGLTNAPATF 745



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           DF   Y+DDI++YSR   +H  HL  +  +L+   +L ++   C
Sbjct: 759 DFVVVYLDDIVIYSRTLEEHVNHLSLVLSQLR-KYTLYVKMEKC 801


>UniRef50_Q8S653 Cluster: Putative retroelement; n=1; Oryza
           sativa|Rep: Putative retroelement - Oryza sativa (Rice)
          Length = 1043

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 24/81 (29%), Positives = 49/81 (60%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ ++ + + +  +KC F    + +LG+ I   G      +++A++D+P+P+ ++ LR F
Sbjct: 580 FQLLQQHELYVKASKCSFAKSHLEYLGHIIGVAGVSTDLGKVKAVQDWPVPKNLRQLRGF 639

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G+V YYR+F++    +  PL
Sbjct: 640 LGLVGYYRKFIQGYGLMTNPL 660



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 26/56 (46%), Positives = 30/56 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFA 173
           +DL   Y QI +   D  K A  T  G YEF  M FGL NA  TFQ  ++  TIFA
Sbjct: 495 LDLRSGYHQIRLTECDEAKRAFRTHHGHYEFRVMPFGLTNAPATFQGLMN--TIFA 548



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 16/39 (41%), Positives = 26/39 (66%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           +VDDIL+YS+    H +HLR +F+ L+  E L ++ + C
Sbjct: 558 FVDDILIYSQTLEDHVSHLREVFQLLQQHE-LYVKASKC 595


>UniRef50_Q7XKP3 Cluster: OSJNBa0032N05.6 protein; n=3; Oryza
            sativa|Rep: OSJNBa0032N05.6 protein - Oryza sativa (Rice)
          Length = 1528

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 26/86 (30%), Positives = 49/86 (56%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            + + + ++ +    +KC F   EV FLG+ ISA G       ++++ ++  P+TV  +R 
Sbjct: 829  ALEKLREHQLYAKFSKCEFWLSEVKFLGHVISAGGVAVDPSNVESVTNWKQPKTVSEIRS 888

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAI 498
            F+G+  YYRRF+ N +K+  P+   +
Sbjct: 889  FLGLAGYYRRFIENFSKIAKPMTRLL 914



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GL+E   M+FGL NA   F   +++
Sbjct: 745 IDLRSGYHQLRIKEEDIPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNK 795



 Score = 36.3 bits (80), Expect = 0.69
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YSR   +H  HLR   ++L+
Sbjct: 793 MNKVFMEYLDKFVVVFIDDILIYSRTKEEHEEHLRLALEKLR 834


>UniRef50_Q2HW78 Cluster: RNA-directed DNA polymerase; n=2; Medicago
           truncatula|Rep: RNA-directed DNA polymerase - Medicago
           truncatula (Barrel medic)
          Length = 579

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 34/114 (29%), Positives = 56/114 (49%), Gaps = 4/114 (3%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++  +    +KC F   EV+FLG+ IS DG      +++A+  +  P++V  +R  +
Sbjct: 374 QVLKEKKLYAKLSKCEFWLKEVSFLGHVISGDGIVVDPSKVEAVSQWETPKSVTEIRSLL 433

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAIVATEVKV----SHRSLGHLSSKNALMPVKI 576
           G+  YYRRF+   +KL  PL       +  V      +S G L  +    PV I
Sbjct: 434 GLAGYYRRFIEGFSKLALPLTQLTCKGKTFVWDVHCEKSFGELKKRLTTAPVLI 487



 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 22/50 (44%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           IDL   Y QI V  ED+ KTA  T +G YE+  M FG+ NA   F  +++
Sbjct: 288 IDLRSGYHQIKVKDEDMQKTAFRTRYGHYEYKVMPFGVTNAPGVFMEYMN 337



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +++I+    D F   ++DDIL+YS+   +HA HL+ + + LK
Sbjct: 336 MNRIFHAFLDRFVVVFIDDILIYSKTEEEHAEHLKIVLQVLK 377


>UniRef50_Q10GU0 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            subclass; n=2; Oryza sativa (japonica
            cultivar-group)|Rep: Retrotransposon protein, putative,
            Ty3-gypsy subclass - Oryza sativa subsp. japonica (Rice)
          Length = 1343

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 28/78 (35%), Positives = 45/78 (57%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            + ++ +    +KC F   EV FLG+ ISA G     E + A+ D+  P+TV  +  F+G+
Sbjct: 867  LREHQLYAKLSKCEFWLSEVKFLGHVISAKGVAVAPETVTAVTDWKQPKTVTQVHSFLGL 926

Query: 433  VNYYRRFLRNAAKLQAPL 486
              YYRRF+ N +K+  P+
Sbjct: 927  AGYYRRFIENFSKIARPM 944



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 779 IDLRSGYHQLRIREEDIPKTAFTTRYGLYEFTVMSFGLTNAPAFFMNLMNK 829



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDILVYS+   +H  HLR +  +L+
Sbjct: 827 MNKVFMEYLDKFVVVFIDDILVYSQSEKEHQQHLRLVLGKLR 868


>UniRef50_Q0IR52 Cluster: Os11g0677100 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os11g0677100 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 1445

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 26/75 (34%), Positives = 45/75 (60%)
 Frame = +1

Query: 274 INPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRF 453
           +  +KC F  P+V++LG+ I A G     ++IQ +  +P P +V+ LR F+G+  YYR+F
Sbjct: 693 VKMSKCSFAQPQVSYLGHIIGAQGVSTEPKKIQDVLTWPTPISVKKLRGFLGLAGYYRKF 752

Query: 454 LRNAAKLQAPLVNAI 498
           ++N   +  PL   +
Sbjct: 753 VKNFGIISKPLTQLL 767



 Score = 40.3 bits (90), Expect = 0.042
 Identities = 22/58 (37%), Positives = 30/58 (51%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +DL   Y QI + P +  KTA  T    YE+  M+FGL  A  TFQ  +++     LR
Sbjct: 598 LDLRAGYHQIRMVPGEEHKTAFQTHSSHYEYRVMSFGLTGAPATFQGVMNKTLASVLR 655


>UniRef50_Q0DBF1 Cluster: Os06g0570000 protein; n=1; Oryza sativa
           (japonica cultivar-group)|Rep: Os06g0570000 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 1186

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 27/80 (33%), Positives = 48/80 (60%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++ + +    +KC F   ++ +LG+ ISA+G     E+ + ++D+PLP  V  LR F+
Sbjct: 526 QLLQQHQLCAKLSKCSFPQNKLEYLGHIISAEGVATDPEKTRVMQDWPLPSNVTELRGFL 585

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G+  YYR+F+++   L  PL
Sbjct: 586 GLTGYYRKFVKHYGILAKPL 605



 Score = 38.3 bits (85), Expect = 0.17
 Identities = 23/56 (41%), Positives = 30/56 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFA 173
           +DL   Y QI +   D  KTA  T    ++F  M FGL NA  TFQ  ++  +IFA
Sbjct: 440 LDLRSGYHQIRMLETDEFKTAFKTHHAHFQFRVMPFGLTNAPATFQCLMN--SIFA 493


>UniRef50_A5AZA3 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1357

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 26/92 (28%), Positives = 48/92 (52%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F+ I  + + +NP KC FG      LG+ +S  G +   ++I+A+ D P P+T + +R F
Sbjct: 882  FERIRKFRLRLNPKKCTFGVTSGKLLGHMVSEPGIEVDPDKIKAILDMPAPKTEKEIRSF 941

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKV 519
            +G + Y  RF+     +  P+   +   + K+
Sbjct: 942  LGRLQYINRFIARLTDICEPIFRLLRKNQPKI 973



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 22/41 (53%), Positives = 28/41 (68%)
 Frame = +3

Query: 24  YQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           Y QI +APED+ KT  IT +G Y +  M FGL+N G T+QR
Sbjct: 803 YNQILMAPEDMEKTTFITEWGTYCYRVMPFGLKNVGATYQR 843


>UniRef50_Q9UVC1 Cluster: Pol polyprotein; n=2; Capnodiales|Rep: Pol
           polyprotein - Cladosporium fulvum (Fulvia fulva)
          Length = 1243

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 28/81 (34%), Positives = 48/81 (59%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ +   G    P KC F   EV FLG  IS  G      + Q+++++P P+TV+ ++ F
Sbjct: 496 FERLTKSGFKTAPEKCEFHKKEVKFLGFIISTTGITIDPAKTQSIREWPEPKTVKDVQSF 555

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G+ NY R+F+++ +K  AP+
Sbjct: 556 LGLANYNRKFIKDYSKTAAPM 576



 Score = 39.5 bits (88), Expect = 0.074
 Identities = 22/51 (43%), Positives = 29/51 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL  A+  I +A  +  KTA  T +GLYEF  M  GL NA  + Q  ++E
Sbjct: 410 IDLRDAFYAIRMAEGEEWKTAFRTRYGLYEFLVMPMGLTNAPASCQDLVNE 460



 Score = 34.3 bits (75), Expect = 2.8
 Identities = 18/42 (42%), Positives = 28/42 (66%), Gaps = 2/42 (4%)
 Frame = +2

Query: 137 VSKIYRRSYDFCF-AYVDDILVYSRDALQ-HAAHLRTLFKRL 256
           V++  R   D C  AY+DDILVY++ +LQ H   ++ +F+RL
Sbjct: 458 VNETLRDLLDVCVVAYMDDILVYTKGSLQEHTKQVQDVFERL 499


>UniRef50_P20825 Cluster: Retrovirus-related Pol polyprotein from
           transposon 297 [Includes: Protease (EC 3.4.23.-);
           Reverse transcriptase (EC 2.7.7.49); Endonuclease]; n=7;
           Drosophila|Rep: Retrovirus-related Pol polyprotein from
           transposon 297 [Includes: Protease (EC 3.4.23.-);
           Reverse transcriptase (EC 2.7.7.49); Endonuclease] -
           Drosophila melanogaster (Fruit fly)
          Length = 1059

 Score = 62.5 bits (145), Expect = 9e-09
 Identities = 27/102 (26%), Positives = 55/102 (53%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  + D  + +   KC F   E  FLG+ ++ DG +P   +++A+  +P+P   + +R F
Sbjct: 385 FTKLADANLKLQLDKCEFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIRAF 444

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSS 549
           +G+  YYR+F+ N A +  P+ + +     K+  + L ++ +
Sbjct: 445 LGLTGYYRKFIPNYADIAKPMTSCL-KKRTKIDTQKLEYIEA 485



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 27/48 (56%), Positives = 30/48 (62%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           TIDL K + QI +  E I KTA  T  G YE+  M FGLRNA  TFQR
Sbjct: 299 TIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPATFQR 346


>UniRef50_UPI00015B6135 Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 505

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 23/75 (30%), Positives = 47/75 (62%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + +  + + P KC F   EV +LG+ +S +G +P  ++++A+++FPL +T + +  F+G+
Sbjct: 430 LREANLKLQPDKCEFLKKEVIYLGHLLSKEGVKPDPKKLEAVRNFPLSKTQKNICEFLGL 489

Query: 433 VNYYRRFLRNAAKLQ 477
             YYR+F++     Q
Sbjct: 490 AGYYRQFIKEVISCQ 504


>UniRef50_UPI0000F1F9FD Cluster: PREDICTED: similar to gag-protease;
           n=1; Danio rerio|Rep: PREDICTED: similar to gag-protease
           - Danio rerio
          Length = 663

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 28/80 (35%), Positives = 47/80 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q + +  + +   KC F    V FLG  IS  G      +++ + D+P+P++   L+RF+
Sbjct: 455 QRLLENRLFVKSEKCDFHTRSVPFLGYIISDKGVSMDPAKLRGITDWPIPESRIALQRFL 514

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G  N+YRRF+RN +++ APL
Sbjct: 515 GFSNFYRRFIRNFSQIVAPL 534


>UniRef50_Q65353 Cluster: ORF B; n=7; root|Rep: ORF B - Autographa
           californica nuclear polyhedrosis virus (AcMNPV)
          Length = 1084

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 27/85 (31%), Positives = 51/85 (60%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ + +    I   K  F   E  +LG+ IS DG +P  ++I A++ + +P+T + +++F
Sbjct: 317 FQRLRESNFKIQMDKSEFLKLETAYLGHIISRDGIKPNPDKISAIQKYLIPKTPKEIKQF 376

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G++ YYR+F+ + A+L  PL   +
Sbjct: 377 LGLLGYYRKFIPDFARLTKPLTQCL 401



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 22/51 (43%), Positives = 31/51 (60%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+DL   + Q+ + P+DI KTA     G +EF  M  GL+N+  TFQR +D
Sbjct: 231 TLDLASGFYQVEMDPQDISKTAFNVEHGHFEFLRMPMGLKNSPSTFQRVMD 281



 Score = 35.5 bits (78), Expect = 1.2
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           + C  Y+DDI+VYS    +H  +L  +F+RL+
Sbjct: 290 NICLVYLDDIIVYSTSLQEHLENLERVFQRLR 321



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 16/50 (32%), Positives = 27/50 (54%)
 Frame = +3

Query: 528 ITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           +T +PE    F  CK  L++  ++ +P    E  L TDAS+  +GA  ++
Sbjct: 407 VTLSPEYVNAFEHCKTLLTNDPILQYPDFTREFNLTTDASNFAIGAVLSQ 456


>UniRef50_Q0DJL7 Cluster: Os05g0263200 protein; n=13; Eukaryota|Rep:
            Os05g0263200 protein - Oryza sativa subsp. japonica
            (Rice)
          Length = 1820

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 27/70 (38%), Positives = 42/70 (60%)
 Frame = +1

Query: 277  NPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFL 456
            N  KC F   +V FLG  +S  G Q    +++A+KD+P P+ V  ++ F G+  +YRRF+
Sbjct: 906  NLEKCTFCTDQVVFLGFVVSGLGIQVDESKVKAIKDWPTPENVSQVKSFRGLAGFYRRFV 965

Query: 457  RNAAKLQAPL 486
            R  + + APL
Sbjct: 966  RGFSTIAAPL 975



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 24/50 (48%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           IDL   + QI +   D  KTA  T FGLYE+  M FGL NA  TF R ++
Sbjct: 810 IDLRSGFHQIRMKIGDEWKTAFKTKFGLYEWLVMPFGLTNAPSTFMRLMN 859


>UniRef50_Q01JC4 Cluster: OSIGBa0122F23.6 protein; n=116; cellular
            organisms|Rep: OSIGBa0122F23.6 protein - Oryza sativa
            (Rice)
          Length = 1346

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 34/117 (29%), Positives = 59/117 (50%), Gaps = 5/117 (4%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            + + + ++ +    +KC F   EV FLG+ IS+ G       ++++  +  P+TV  +R 
Sbjct: 653  ALEKLREHQLYAKFSKCEFWLSEVKFLGHVISSGGVAVDPSNVESVLSWKQPKTVSEIRS 712

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVS-----HRSLGHLSSKNALMPVKI 576
            F+G+  YYRRF+ N +K+  P+   ++  EVK        RS   L  +    PV I
Sbjct: 713  FLGLAGYYRRFIENFSKIARPMTR-LLQKEVKYKWTEDCERSFQELKKRLVTAPVLI 768



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GL+E   M+FGL NA   F   +++
Sbjct: 569 IDLRSGYHQLRIREEDIPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNK 619



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 14/42 (33%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YS+   +H  HLR   ++L+
Sbjct: 617 MNKVFMEYLDKFVVVFIDDILIYSKTKEEHEEHLRLALEKLR 658


>UniRef50_A5JSC4 Cluster: Polyprotein; n=8; Poaceae|Rep: Polyprotein
           - Zea mays (Maize)
          Length = 1476

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 28/90 (31%), Positives = 53/90 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q + ++ +    +KC F   E+ FLG+ IS DG     +++Q + ++  P TV+ +R F+
Sbjct: 718 QRLREHHLYAKLSKCDFWLKEIKFLGHTISQDGIAVDPDKVQEVMNWRPPTTVRQIRSFL 777

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAIVATEVK 516
           G+  YYRRF+ + +++  P +  ++  EVK
Sbjct: 778 GLAGYYRRFIPDFSRIAKP-ITELLKKEVK 806



 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/45 (53%), Positives = 27/45 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTF 140
           IDL   Y QI +   DI KTA  T +GLYEF  M+FGL NA   F
Sbjct: 632 IDLRSGYHQIKIRASDIPKTAFSTRYGLYEFLVMSFGLTNAPAYF 676



 Score = 37.1 bits (82), Expect = 0.39
 Identities = 14/31 (45%), Positives = 22/31 (70%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   ++DDILVYS++  +HA HL  + +RL+
Sbjct: 691 FVVVFIDDILVYSKNEEEHAEHLHVVLQRLR 721


>UniRef50_A5BRL2 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1122

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 25/86 (29%), Positives = 48/86 (55%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           +F+ +  +   +  +KC FG  E+ +LG+ ++  G Q    +I+A+ ++P P  +  L  
Sbjct: 372 AFEILRQHQFFVKISKCAFGQXELEYLGHIVTXXGVQVDXGKIKAMLNWPRPTNISELHG 431

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAI 498
           F+G+  YYR+F+RN   +   L N +
Sbjct: 432 FLGLTGYYRKFVRNYGIIARALTNLL 457



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 23/50 (46%), Positives = 28/50 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL   Y  + V P DI KTA  T  G YE+  M FGL NA  TFQ  ++
Sbjct: 288 LDLRAGYHYVRVHPPDIPKTAFRTHNGHYEYLVMPFGLSNAPSTFQAIMN 337


>UniRef50_A5ARJ4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 462

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 29/111 (26%), Positives = 57/111 (51%), Gaps = 2/111 (1%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           +F    +    I   KCVFG  E+ +LG+ ++  G +     I+ + ++P P  +  L  
Sbjct: 95  AFDIYNNTSFFIKAKKCVFGKHELEYLGHIVTNQGVKMDQRNIEVMINWPRPYDILALCD 154

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAIVATE--VKVSHRSLGHLSSKNALMP 567
           F+G+++YYR+F++N   +  PL N +   +  +++  RSL +   +    P
Sbjct: 155 FLGLISYYRKFVQNYGLIARPLTNLLKKGKFFIQIDQRSLRYFMEQRIGTP 205


>UniRef50_P34431 Cluster: Uncharacterized protein F44E2.2; n=5;
            Caenorhabditis elegans|Rep: Uncharacterized protein
            F44E2.2 - Caenorhabditis elegans
          Length = 2186

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 27/84 (32%), Positives = 48/84 (57%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            I   G+ +  +KC     EV +LG++++ DG +    +   +K F  P  V+ L+ F+G+
Sbjct: 1119 IRKSGMKLRASKCHIAKKEVEYLGHKVTLDGVETQEVKTDKMKQFSRPTNVKELQSFLGL 1178

Query: 433  VNYYRRFLRNAAKLQAPLVNAIVA 504
            V YYR+F+ N A++ + L + I A
Sbjct: 1179 VGYYRKFILNFAQIASSLTSLISA 1202


>UniRef50_UPI00015B47E1 Cluster: PREDICTED: hypothetical protein;
           n=2; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 1773

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 29/89 (32%), Positives = 53/89 (59%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q + +  +V+ P K  F   +V FLG+ ISA G +P  E++ A+     P++ + +R  +
Sbjct: 443 QILREAKLVLQPDKIEFFGKKVGFLGHIISARGVEPNPEKVAAIAKLATPKSAKNIREVL 502

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAIVATEV 513
           GM  YYR+++++ AK+ A L+N ++   V
Sbjct: 503 GMFGYYRKYIKDFAKI-AKLLNNLLKKNV 530



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 26/51 (50%), Positives = 33/51 (64%)
 Frame = +3

Query: 9   DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           DL   +QQIP+APED  KTA  T  G YE+  M  GL+N   T+QR I++A
Sbjct: 358 DLASGFQQIPMAPEDCYKTAFTTINGHYEYTRMPEGLKNTTATYQRLIEKA 408



 Score = 34.3 bits (75), Expect = 2.8
 Identities = 18/48 (37%), Positives = 24/48 (50%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WT + EE F   K  L    ++  P  N EL L TDAS   +GA  ++
Sbjct: 534 WTEKCEESFEKLKHCLMEEPILQFPDFNKELTLTTDASDYAIGAVLSQ 581


>UniRef50_UPI00015B4428 Cluster: PREDICTED: similar to protease,
           reverse transcriptase and RNase H; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to protease, reverse
           transcriptase and RNase H - Nasonia vitripennis
          Length = 429

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 26/85 (30%), Positives = 48/85 (56%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ +  +   +N  K  F   E  FLG  +S  G +P   +I+A+K++P+ + ++ L+ F
Sbjct: 340 FQNLIKWNFTLNLTKTEFFKKETNFLGFILSTTGIKPQDNKIEAIKNYPISKNIKQLQAF 399

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G +N+Y +F +N A    PL+  +
Sbjct: 400 LGTINFYAKFTKNRANELIPLLELL 424


>UniRef50_UPI0000E47417 Cluster: PREDICTED: similar to transposase;
           n=2; Deuterostomia|Rep: PREDICTED: similar to
           transposase - Strongylocentrotus purpuratus
          Length = 1376

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 29/81 (35%), Positives = 46/81 (56%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ   +  I +N  K VF A E+ FLG+ +++ G QP  +++  +   P P  VQG++R 
Sbjct: 673 FQRCVEQHIKLNKEKSVFRATEIPFLGHVVTSAGLQPDPKKVADVLKMPNPSDVQGVQRL 732

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G VNY  RFL + +    P+
Sbjct: 733 VGFVNYLSRFLPSLSDTLEPI 753


>UniRef50_Q7XW82 Cluster: OSJNBa0019J05.12 protein; n=8; Oryza sativa
            (japonica cultivar-group)|Rep: OSJNBa0019J05.12 protein -
            Oryza sativa subsp. japonica (Rice)
          Length = 1817

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 26/72 (36%), Positives = 44/72 (61%)
 Frame = +1

Query: 283  AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
            +KC F   ++T+LG+ ISA G      +IQ + ++ +P TV+ LR F+G+  YYR+F++ 
Sbjct: 984  SKCSFAQKQLTYLGHTISAAGVHTDQGKIQEVVNWKVPTTVKKLRGFLGLAGYYRKFVKG 1043

Query: 463  AAKLQAPLVNAI 498
               +  PL N +
Sbjct: 1044 FGVISKPLTNLL 1055



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/58 (43%), Positives = 32/58 (55%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
            +DL   Y QI +AP +  KTA  T  G YE+  M+FGL  A  TFQ  ++E     LR
Sbjct: 886  LDLRAGYHQIRMAPGEEYKTAFQTHTGHYEYTVMSFGLTGAPATFQGAMNETLSPVLR 943



 Score = 37.9 bits (84), Expect = 0.22
 Identities = 21/55 (38%), Positives = 31/55 (56%)
 Frame = +3

Query: 513  KGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
            KG+ P  WTPE +  F+  K +L SA ++A P       + TDAS S +GA  ++
Sbjct: 1057 KGV-PFIWTPETDAAFHNLKQALVSAPVLALPDFQKVFTVETDASDSGIGAVLSQ 1110


>UniRef50_Q7XQR2 Cluster: OSJNBa0091D06.2 protein; n=3; Oryza
           sativa|Rep: OSJNBa0091D06.2 protein - Oryza sativa
           (Rice)
          Length = 877

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 26/72 (36%), Positives = 44/72 (61%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F   ++T+LG+ ISA G      +IQ + D+ +P +V+ LR F+G+  YYR+F++ 
Sbjct: 728 SKCSFAQRQLTYLGHTISAAGVHTDKNKIQEVVDWKVPISVKKLRGFLGLAGYYRKFVKG 787

Query: 463 AAKLQAPLVNAI 498
              +  PL N +
Sbjct: 788 FGVISKPLTNLL 799



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/58 (43%), Positives = 33/58 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +DL   Y QI +AP +  KTA  T  G YE+  M+FGL  A  TFQR +++     LR
Sbjct: 630 LDLRAGYHQIRMAPGEEYKTAFQTHTGHYEYTVMSFGLTEAPATFQRAMNDTLKTVLR 687


>UniRef50_Q6L3M7 Cluster: Gag-pol protein, putative; n=4;
            Magnoliophyta|Rep: Gag-pol protein, putative - Solanum
            demissum (Wild potato)
          Length = 1554

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 26/80 (32%), Positives = 48/80 (60%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q ++D  +    +KC F    V FLG+ +S DG +  + +I+A++++P P +   +R F+
Sbjct: 918  QTLKDNKLYAKFSKCEFWLKSVAFLGHIVSGDGIKVDTGKIEAMQNWPRPTSPTEIRSFL 977

Query: 427  GMVNYYRRFLRNAAKLQAPL 486
            G+  YYRRF+   + + +PL
Sbjct: 978  GLAGYYRRFVEGFSSIASPL 997



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 23/45 (51%), Positives = 26/45 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTF 140
           IDL   Y Q+ V   DI KTA  T +G YEF  M+FGL NA   F
Sbjct: 832 IDLRSGYHQLRVRECDIPKTAFRTRYGHYEFLVMSFGLTNAPAAF 876



 Score = 42.3 bits (95), Expect = 0.010
 Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137  VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            ++++++   D F   ++DDILVYSR+   HA+HLRT+ + LK
Sbjct: 880  MNRVFKPYLDTFVIVFIDDILVYSRNEEDHASHLRTVLQTLK 921


>UniRef50_Q2R2J9 Cluster: Retrotransposon protein, putative, Ty3-gypsy
            subclass; n=6; Oryza sativa|Rep: Retrotransposon protein,
            putative, Ty3-gypsy subclass - Oryza sativa subsp.
            japonica (Rice)
          Length = 1762

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 26/86 (30%), Positives = 49/86 (56%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            + + + ++ +    +KC F   EV FLG+ ISA G       ++++ ++  P+TV  +  
Sbjct: 1087 ALEKLREHQLYAKFSKCEFWLSEVKFLGHVISAGGDAVDPSNVESVTNWKQPKTVSEIHS 1146

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAI 498
            F+G+V YYRRF+ N +K+  P+   +
Sbjct: 1147 FLGLVGYYRRFIENFSKIAKPMTRLL 1172



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/51 (41%), Positives = 29/51 (56%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            IDL   Y Q+ +  EDI KT   T +GL+E   M+FGL NA   F   +++
Sbjct: 1003 IDLRSGYHQLRIKEEDIPKTTFTTRYGLFECTVMSFGLTNAPAFFMNLMNK 1053



 Score = 36.3 bits (80), Expect = 0.69
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137  VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            ++K++    D F   ++DDIL+YSR   +H  HLR   ++L+
Sbjct: 1051 MNKVFMEYLDKFVVVFIDDILIYSRTKEEHEEHLRLALEKLR 1092


>UniRef50_Q01LW3 Cluster: OSIGBa0139I12.1 protein; n=2; Oryza
            sativa|Rep: OSIGBa0139I12.1 protein - Oryza sativa (Rice)
          Length = 1585

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 28/92 (30%), Positives = 52/92 (56%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            + + + ++ +    +KC F   EV FLG+ IS+ G       ++++  +  P+TV  +R 
Sbjct: 932  ALEKLREHQLYAKFSKCEFWLSEVKFLGHVISSGGVAVDPSNVESVLSWKQPKTVSEIRS 991

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAIVATEVK 516
            F+G+  YYRRF+ N +K+  P+   ++  EVK
Sbjct: 992  FLGLAGYYRRFIENFSKIARPMTR-LLQKEVK 1022



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            IDL   Y Q+ +  EDI KTA  T +GL+E   M+FGL NA   F   +++
Sbjct: 848  IDLRSGYHQLRIREEDIPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNK 898



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 14/42 (33%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137  VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            ++K++    D F   ++DDIL+YS+   +H  HLR   ++L+
Sbjct: 896  MNKVFMEYLDKFVVVFIDDILIYSKRKEEHEEHLRLALEKLR 937


>UniRef50_Q01JG0 Cluster: H0502G05.6 protein; n=22; root|Rep:
           H0502G05.6 protein - Oryza sativa (Rice)
          Length = 898

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 26/72 (36%), Positives = 44/72 (61%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F   ++T+LG+ ISA G      +IQ + D+ +P +V+ LR F+G+  YYR+F++ 
Sbjct: 749 SKCSFAQRQLTYLGHTISAAGVHTDKNKIQEVVDWKVPISVKKLRGFLGLAGYYRKFVKG 808

Query: 463 AAKLQAPLVNAI 498
              +  PL N +
Sbjct: 809 FGVISKPLTNLL 820



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 25/58 (43%), Positives = 33/58 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +DL   Y QI +AP +  KTA  T  G YE+  M+FGL  A  TFQR +++     LR
Sbjct: 651 LDLRAGYHQIRMAPGEEYKTAFQTHTGHYEYTVMSFGLTEAPATFQRAMNDTLKTVLR 708


>UniRef50_Q01JD2 Cluster: OSIGBa0130P02.7 protein; n=23; Oryza
            sativa|Rep: OSIGBa0130P02.7 protein - Oryza sativa (Rice)
          Length = 1741

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 26/86 (30%), Positives = 49/86 (56%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            + + + ++ +    +KC F   EV FLG+ ISA G       ++++ ++  P+TV  +R 
Sbjct: 977  ALEKLREHQLYAKFSKCEFWLSEVKFLGHVISAGGVVVDPSNVESVTNWKQPKTVSEVRS 1036

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAI 498
            F+G+  YYRRF+ N +K+  P+   +
Sbjct: 1037 FLGLAGYYRRFIENFSKIAKPMTRLL 1062



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            IDL   Y Q+ +  EDI KTA  T +GL+E   M+FGL NA   F   +++
Sbjct: 893  IDLRSGYHQLRIKEEDIPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNK 943



 Score = 36.3 bits (80), Expect = 0.69
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137  VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            ++K++    D F   ++DDIL+YSR   +H  HLR   ++L+
Sbjct: 941  MNKVFMEYLDKFMVVFIDDILIYSRTKEEHEEHLRLALEKLR 982


>UniRef50_A5BVZ6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1289

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 26/92 (28%), Positives = 49/92 (53%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ I  + + +NP KC FG      LG+ +S  G +   E+I+A+ D P P+T + +R F
Sbjct: 569 FERIRQFRLRLNPKKCTFGVTSGKLLGHIVSERGIEVDPEKIRAILDMPAPRTEREIRGF 628

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKV 519
           +G + Y  RF+     +  P+ + +   ++ +
Sbjct: 629 LGRLQYITRFIARLTNICEPIFHLLRKNQLTI 660



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 24/47 (51%), Positives = 30/47 (63%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    Y QI +APEDI KT  IT +G Y +  M F L+NAG T+QR
Sbjct: 505 MDGFSGYNQILMAPEDIEKTFFITEWGTYYYRVMPFRLKNAGATYQR 551


>UniRef50_A5B4Q4 Cluster: Putative uncharacterized protein; n=13;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1595

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 34/119 (28%), Positives = 61/119 (51%), Gaps = 4/119 (3%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           +V++  KC F   +   LG+ IS  G +    +++ +   P P TV+G+R+F+G V +YR
Sbjct: 522 LVLSLEKCHFMVHQGIVLGHIISEKGIEVDKAKVELIVKLPSPTTVKGIRQFLGHVGFYR 581

Query: 448 RFLRNAAKLQAPLVNAIVATEVKV----SHRSLGHLSSKNALMPVKIACHLQLWWHTLC 612
           RF+++ +KL  PL   +V     +      +S   L     + P+  A + QL +  +C
Sbjct: 582 RFIKDFSKLSKPLCELLVKDAKFIWDERCQKSFDQLKQFLTIAPIVRAPNWQLPFEVMC 640



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 15/28 (53%), Positives = 16/28 (57%)
 Frame = +3

Query: 63  TAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           T    PFG Y +  M FGL NA  TFQR
Sbjct: 448 TTFTCPFGTYAYRRMPFGLCNAPATFQR 475


>UniRef50_Q4QQF6 Cluster: Gag-pol polyprotein; n=3; Schistosoma|Rep:
           Gag-pol polyprotein - Schistosoma mansoni (Blood fluke)
          Length = 816

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 28/80 (35%), Positives = 43/80 (53%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q + D G  + P KC      V +LG    A G +P  E I+A++  P P  +  LR F+
Sbjct: 667 QRVSDNGFRLRPEKCQLFLKSVKYLGFIFDAAGRRPDPENIRAIRTMPTPTNISTLRSFL 726

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G+V+YY  F+ +   ++APL
Sbjct: 727 GLVSYYSAFVPSMHDIRAPL 746



 Score = 32.7 bits (71), Expect = 8.4
 Identities = 15/50 (30%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AY Q+ VA +    + ++   GL+++N + FG ++    FQ+ +D
Sbjct: 583 LDLADAYLQVEVAEDQESYSLLLLIGGLFQYNRLPFGGQDRPIYFQQLMD 632


>UniRef50_A0NFM2 Cluster: ENSANGP00000030157; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000030157 - Anopheles gambiae
           str. PEST
          Length = 323

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 26/84 (30%), Positives = 49/84 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q I + G  IN  K  F    V FLG  +  +G +P   + +A+ DFP P +V  +++F+
Sbjct: 36  QIIREEGFTINLEKSHFFKENVEFLGFEVGRNGVRPGETKTKAVTDFPNPMSVHAVQQFL 95

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G+  ++RRF+++ + + AP++  +
Sbjct: 96  GLAGFFRRFVKDFSIIAAPMLKLL 119


>UniRef50_UPI00015B440C Cluster: PREDICTED: hypothetical protein; n=1;
            Nasonia vitripennis|Rep: PREDICTED: hypothetical protein
            - Nasonia vitripennis
          Length = 1818

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 29/83 (34%), Positives = 50/83 (60%)
 Frame = +1

Query: 268  IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
            +V+ P K  F   EV FLG+ IS+ G +   E+++A+   P  +T + +R  +GM  YYR
Sbjct: 902  LVLQPDKIEFFRREVEFLGHIISSRGIESNPEKVEAITKLPTQKTAKNVRTLLGMFGYYR 961

Query: 448  RFLRNAAKLQAPLVNAIVATEVK 516
            +++++ AK+  PL N ++   VK
Sbjct: 962  KYIKDFAKIAKPL-NDLLKKNVK 983



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 24/51 (47%), Positives = 33/51 (64%)
 Frame = +3

Query: 9   DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           +L   +QQIP+APED  KTA  T    YE+  +  GL+NA  TFQR +++A
Sbjct: 810 NLASGFQQIPMAPEDCYKTAFTTLNRHYEYTRLPEGLKNATATFQRLMEKA 860



 Score = 35.1 bits (77), Expect = 1.6
 Identities = 13/33 (39%), Positives = 23/33 (69%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLL 277
           Y+DDI+VYS+D  +H   +R +  RL++ + +L
Sbjct: 872 YLDDIIVYSKDLQEHEQRIRHMMDRLRLAKLVL 904


>UniRef50_UPI0000E47C82 Cluster: PREDICTED: similar to LReO_3; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           LReO_3 - Strongylocentrotus purpuratus
          Length = 896

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/85 (32%), Positives = 46/85 (54%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ +    + +N AK  F    V FLG+ + +   +P S ++ ++  FP+P   + L RF
Sbjct: 652 FERLSIAKMTVNLAKSEFAGGTVLFLGHVVGSGQVRPISAKVDSILAFPIPTNRKELMRF 711

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +GM  YYRRF  N + +  PL N +
Sbjct: 712 LGMAGYYRRFCHNFSDVVTPLTNLL 736



 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 21/49 (42%), Positives = 31/49 (63%)
 Frame = +3

Query: 9   DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           DL+K Y QIP+       +A  TP GL+++  M FG++NA  TFQR ++
Sbjct: 570 DLLKGYWQIPLTKRAQEISAFSTPQGLFQYTVMPFGMKNAPATFQRLVN 618



 Score = 39.9 bits (89), Expect = 0.056
 Identities = 16/33 (48%), Positives = 23/33 (69%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITE 268
           C AY+DDI+VYS +  +H   +R LF+RL I +
Sbjct: 627 CEAYIDDIIVYSEEWNEHVQRIRELFERLSIAK 659


>UniRef50_Q7XXG1 Cluster: OSJNBb0089K24.9 protein; n=1; Oryza sativa
           (japonica cultivar-group)|Rep: OSJNBb0089K24.9 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 1320

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 25/86 (29%), Positives = 49/86 (56%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           + + + ++ +    +KC F   EV FLG+ ISA G       ++++ ++  P+TV  +R 
Sbjct: 713 ALEKLREHQLYAKYSKCEFWLSEVKFLGHVISAGGVAVDPSNVESVTNWEKPKTVSEIRS 772

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAI 498
           F+G+  +YRRF+ N +K+  P+   +
Sbjct: 773 FLGLAGFYRRFIENFSKIAKPMTRML 798



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KT+  T +GL+E   ++FGL NA   F   +++
Sbjct: 629 IDLRSGYHQLRIKEEDIPKTSFTTRYGLFECTVLSFGLTNAPAFFMNLMNK 679



 Score = 36.3 bits (80), Expect = 0.69
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YSR   +H  HLR   ++L+
Sbjct: 677 MNKVFMEYLDKFMVVFIDDILIYSRTREEHEEHLRLALEKLR 718


>UniRef50_Q7XL33 Cluster: OSJNBa0056L23.24 protein; n=1; Oryza sativa
            (japonica cultivar-group)|Rep: OSJNBa0056L23.24 protein -
            Oryza sativa subsp. japonica (Rice)
          Length = 1711

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            +F+ +  YG+ +NP KC FG     FLG  +   G +   ++I+ + DF  P   + +++
Sbjct: 824  AFERMRRYGLKMNPLKCAFGVSAGRFLGFMVHERGVEIDPKKIEKIHDFKAPTCKKEVQK 883

Query: 421  FIGMVNYYRRFLRN-AAKLQA 480
             +G VNY RRF+ N A K+ A
Sbjct: 884  LLGKVNYLRRFISNLAGKIDA 904



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 2/43 (4%)
 Frame = +3

Query: 24  YQQIPVAPEDICKTAIITP--FGLYEFNYMTFGLRNAGQTFQR 146
           Y QI VA ED+ KTA   P   GL+E+  MTF L+NAG  +QR
Sbjct: 744 YNQIFVAEEDMYKTAFRCPGFVGLFEWVVMTFRLKNAGAIYQR 786



 Score = 41.5 bits (93), Expect = 0.018
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLP 396
            +F+ +  YG+ +NP KC FG     FLG  +   G +   + I+ ++DF  P
Sbjct: 1220 AFERMRRYGLKMNPLKCAFGVSAGKFLGFMVHERGAEIDPKMIEKIRDFKAP 1271


>UniRef50_Q0KIP3 Cluster: Polyprotein, 3'-partial, putative; n=4; core
            eudicotyledons|Rep: Polyprotein, 3'-partial, putative -
            Solanum demissum (Wild potato)
          Length = 1475

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/80 (33%), Positives = 45/80 (56%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q + D  +    +KC F    V FLG+ +S +G      +I+A++D+  P +V  +R F+
Sbjct: 851  QTLRDQRLYAKFSKCQFWLDSVAFLGHVVSKEGIMVDPAKIEAIRDWARPTSVTEIRSFV 910

Query: 427  GMVNYYRRFLRNAAKLQAPL 486
            G+  YYRRF+ + + L  PL
Sbjct: 911  GLAGYYRRFVESFSTLATPL 930



 Score = 39.1 bits (87), Expect = 0.097
 Identities = 21/45 (46%), Positives = 25/45 (55%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTF 140
           IDL   Y Q+ +   DI KTA  T +G YE   M+FGL NA   F
Sbjct: 765 IDLRFDYHQLRIRAADIPKTAFRTRYGHYELLVMSFGLTNAPAAF 809



 Score = 36.3 bits (80), Expect = 0.69
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +++++R   D F   ++DDIL+YSR    H  HLR + + L+
Sbjct: 813 MTRVFRPYLDSFVIVFIDDILIYSRSRGDHEQHLRVVLQTLR 854


>UniRef50_Q0J3B5 Cluster: Os09g0135100 protein; n=1; Oryza sativa
           (japonica cultivar-group)|Rep: Os09g0135100 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 1370

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 24/85 (28%), Positives = 46/85 (54%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ ++++ +    +KC F  P + +LG+ IS DG      +   ++ +P+P  +  LR F
Sbjct: 664 FQTLQNHQLFAKLSKCSFATPTLEYLGHTISKDGVATDPAKTACMQQWPVPANITELRGF 723

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+  YYR+F+ +   +  PL   +
Sbjct: 724 LGLTGYYRKFVHHYGIIAKPLTKLL 748



 Score = 43.6 bits (98), Expect = 0.005
 Identities = 25/56 (44%), Positives = 32/56 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFA 173
           +DL   Y QI + PED  KTA  T  G ++   M FGL NA  TFQ  ++  +IFA
Sbjct: 579 LDLRSGYHQIRMLPEDEYKTAFKTHHGHFQSRVMPFGLTNAPATFQYLMN--SIFA 632



 Score = 33.9 bits (74), Expect = 3.7
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           WTPE +  F+A K ++ S  ++A P  +    L TDA    +GA
Sbjct: 756 WTPEADSAFHALKQAMCSTLVLALPDFSKPFALETDACDIGIGA 799



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   ++DDILVYS    +H +HL  +F+ L+
Sbjct: 638 FVLVFMDDILVYSHSWAEHLSHLELVFQTLQ 668


>UniRef50_A5C1Z6 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1268

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 39/126 (30%), Positives = 63/126 (50%), Gaps = 4/126 (3%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q IE   +V+N  KC F  P+   L + IS+ G +    +++ +   P P TV+G+R+F+
Sbjct: 721  QCIEK-DLVLNWEKCHFMVPQGIVLRHIISSQGIEVDKAKVELIVKLPSPTTVKGVRQFL 779

Query: 427  GMVNYYRRFLRNAAKLQAPLVNAIVATEVKV----SHRSLGHLSSKNALMPVKIACHLQL 594
              V +YRRF+++ +KL  PL   +V     V      RS   L       P+  A + QL
Sbjct: 780  SHVEFYRRFIKDFSKLARPLYELLVKDTKFVWNDRCQRSFEELKLLLKTAPIVRAPNWQL 839

Query: 595  WWHTLC 612
             +  +C
Sbjct: 840  PFEVMC 845



 Score = 39.9 bits (89), Expect = 0.056
 Identities = 21/41 (51%), Positives = 22/41 (53%)
 Frame = +3

Query: 24  YQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           Y QI  A ED  KT    PFG Y +  M FGL N   TFQR
Sbjct: 640 YFQIENAVEDQEKTTFTCPFGTYAYRRMPFGLCNTPATFQR 680


>UniRef50_A5BTF9 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1209

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 36/119 (30%), Positives = 58/119 (48%), Gaps = 4/119 (3%)
 Frame = +1

Query: 268  IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
            +V+N  KC F  P+   LG+ I   G +    +++ +   P P TV+G+R+F+G   +YR
Sbjct: 716  LVLNWEKCHFMIPQGIILGHIIFKQGIEVDKAKVELIVKLPSPTTVKGVRQFLGHAGFYR 775

Query: 448  RFLRNAAKLQAPLVNAIVATEVKV----SHRSLGHLSSKNALMPVKIACHLQLWWHTLC 612
            RF+++  KL  PL   +V     V      RS   L       P+  A + QL +  +C
Sbjct: 776  RFIKDFFKLARPLCELLVRNAKFVWDDRCQRSFEELKLLLTTAPIVRAPNWQLPFEVMC 834



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 22/47 (46%), Positives = 26/47 (55%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    Y QI +  ED  KT    PFG Y +  M+FGL NA  TFQR
Sbjct: 623 LDGYSGYFQIEIVVEDQEKTTFTCPFGTYAYKRMSFGLCNAPVTFQR 669


>UniRef50_A5BSX6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 790

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 28/78 (35%), Positives = 47/78 (60%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +K  FG  +V +LG+ IS  G      +IQA+ ++P   T +G+R F+G+  YYR+F+R+
Sbjct: 121 SKFRFGVLQVEYLGHIISEQGVSVDPAKIQAVIEWPTLTTAKGVRGFLGLAGYYRKFIRH 180

Query: 463 AAKLQAPLVNAIVATEVK 516
              + APL   +  T++K
Sbjct: 181 FGSIAAPLTPEMTFTQLK 198



 Score = 36.7 bits (81), Expect = 0.52
 Identities = 20/42 (47%), Positives = 24/42 (57%)
 Frame = +3

Query: 33  IPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           I V  +DI KT   T  G YEF  M FGL NA  TFQ  +++
Sbjct: 46  IRVHEDDIPKTVFWTHEGHYEFIVMPFGLTNAPATFQSLMND 87


>UniRef50_A5B9Y2 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 587

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 24/71 (33%), Positives = 47/71 (66%)
 Frame = +1

Query: 286 KCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNA 465
           KC F    + FLG  +SA+G +    +++A++ +P+P+TV  +R F G+ ++YRRF++N 
Sbjct: 155 KCRFFTDSLLFLGYIVSAEGIKVDDSKVKAIRSWPMPKTVGEVRSFHGLASFYRRFIKNF 214

Query: 466 AKLQAPLVNAI 498
           + + AP+ + +
Sbjct: 215 STIIAPITDCM 225



 Score = 40.7 bits (91), Expect = 0.032
 Identities = 23/51 (45%), Positives = 28/51 (54%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y QI +   D  KTA     GLYE+  M FGL NA  TF R +++
Sbjct: 82  IDLKSGYHQIRIREGDEWKTAFN---GLYEWTVMLFGLSNAPSTFMRLMNQ 129


>UniRef50_A5AI26 Cluster: Putative uncharacterized protein; n=5;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 905

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 26/49 (53%), Positives = 34/49 (69%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +D    Y QIP++P D+ KTA ITP GLY +  M FGL+NAG T+QR +
Sbjct: 100 LDAFSGYHQIPMSPADVEKTAFITPHGLYCYRVMPFGLKNAGATYQRLM 148



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 23/85 (27%), Positives = 41/85 (48%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ ++ Y + +N  KC F      FLG  +S  G +   ++++A+ + P P++ + L+R 
Sbjct: 185 FQLLKKYDMKLNHFKCAFSVSVGKFLGFMVSQRGIEVSLDQVKAVMETPPPRSKKELQRL 244

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
            G +    RF+        P   AI
Sbjct: 245 TGKLVALGRFIARFTDELRPFFLAI 269


>UniRef50_A5AG41 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1173

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 26/74 (35%), Positives = 46/74 (62%)
 Frame = +1

Query: 277 NPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFL 456
           N  KC F   +V FLG  +SA G +   E ++++K++P P+ +  +R F G+ ++YRRF+
Sbjct: 585 NLKKCSFCMDKVVFLGYVVSAKGIEVDEENVKSIKEWPTPKLITEVRSFHGLASFYRRFV 644

Query: 457 RNAAKLQAPLVNAI 498
           ++ + L APL   +
Sbjct: 645 KDFSTLVAPLTEIV 658



 Score = 41.1 bits (92), Expect = 0.024
 Identities = 22/49 (44%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
 Frame = +3

Query: 51  DICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA-TIFALRTLTTY 194
           D  KTA  T +GLYE+  M FGL NA  TF R ++ A  +F  R +  Y
Sbjct: 504 DEWKTAFKTKYGLYEWLVMPFGLTNAPSTFMRLMNHALRVFISRFVVVY 552


>UniRef50_Q6RYC6 Cluster: Gag-pol polyprotein; n=5; Dikarya|Rep:
            Gag-pol polyprotein - Aspergillus flavus
          Length = 1998

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 26/71 (36%), Positives = 45/71 (63%)
 Frame = +1

Query: 286  KCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNA 465
            KC F   E  FLG+ IS +G Q    +++A++++P P  ++ L++F G++NYYR+F+   
Sbjct: 1249 KCEFHVQETEFLGHWISTEGIQAEEGKVKAIREWPEPTNLKELQQFTGLLNYYRKFIDRY 1308

Query: 466  AKLQAPLVNAI 498
            A   APL + +
Sbjct: 1309 AHKLAPLFDLL 1319



 Score = 49.2 bits (112), Expect = 9e-05
 Identities = 24/52 (46%), Positives = 33/52 (63%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
            +D+  AY +  +A  +  KTA  T +G YE+  M FGL NA  +FQRFI+EA
Sbjct: 1150 LDITDAYHRRRIAEGEEWKTAFRTKYGHYEYLVMPFGLTNAPASFQRFINEA 1201



 Score = 36.3 bits (80), Expect = 0.69
 Identities = 13/34 (38%), Positives = 24/34 (70%)
 Frame = +2

Query: 167  FCFAYVDDILVYSRDALQHAAHLRTLFKRLKITE 268
            F  AY+DDIL++S +  +H  H++T+ ++L+  E
Sbjct: 1209 FVIAYLDDILIFSHNLEEHVQHVQTVLEKLRKAE 1242


>UniRef50_UPI00015B48F4 Cluster: PREDICTED: similar to protease,
           reverse transcriptase and RNase H; n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to protease, reverse
           transcriptase and RNase H - Nasonia vitripennis
          Length = 1204

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 28/85 (32%), Positives = 49/85 (57%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ   D G+ IN  K  F   E+ FLG  ++ +G +P  E++Q + ++P+PQ V+ L+ F
Sbjct: 593 FQRCSDEGVTINFKKVKFCRQEMRFLGYILTPEGIKPDEEKVQGIYNYPVPQNVKQLKGF 652

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
            G++N+  +F  + A    PL+  +
Sbjct: 653 HGVLNFSSKFTSSLASEVNPLLRLL 677


>UniRef50_UPI0000F21214 Cluster: PREDICTED: similar to LReO_3; n=6;
            Danio rerio|Rep: PREDICTED: similar to LReO_3 - Danio
            rerio
          Length = 1293

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 25/86 (29%), Positives = 51/86 (59%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            + + I+  G+ +N  KC +G  E  +LG  +   G +P  ++++A+K    P+T + +R 
Sbjct: 1018 TLEKIQAAGLSLNVVKCEWGRGETNYLGYILGNGGLRPQVDKVEAIKKSQRPRTKKEVRS 1077

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAI 498
            F+G++ +YRRF+ +   + APL + +
Sbjct: 1078 FLGLLGWYRRFIPDFTAIAAPLTDLL 1103



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 24/52 (46%), Positives = 31/52 (59%)
 Frame = +3

Query: 3    TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            T+DL K Y Q+P+       TA  TP GLY+F  + FGL  A  TFQR +D+
Sbjct: 934  TLDLCKDYWQVPLHHSSKALTAFRTPVGLYQFTVLPFGLHGAPATFQRLMDQ 985


>UniRef50_UPI0000F1E127 Cluster: PREDICTED: similar to transposase;
           n=1; Danio rerio|Rep: PREDICTED: similar to transposase
           - Danio rerio
          Length = 1269

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 31/111 (27%), Positives = 57/111 (51%), Gaps = 4/111 (3%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + I + G+ +N  KC F  PE+ + G+ IS +G +P +  + A+ + P P  V  LR+ +
Sbjct: 586 KTIRESGLKLNRDKCHFNKPELRYFGHTISQNGIKPDATMVTAITEMPSPTNVTELRQIL 645

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAIVATEV----KVSHRSLGHLSSKNALMP 567
           GM+NY  +F+   + +  P+   +    V    +V  ++L  + S  A  P
Sbjct: 646 GMINYLGKFVPGLSTVLQPVTALLKKDAVWIWSEVQEQALSKVKSMLATAP 696



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 20/55 (36%), Positives = 31/55 (56%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATI 167
           T+D    + QIP+ P  +  T  ITP G + FN + FG+ +A + FQR + +  I
Sbjct: 501 TLDASSGFWQIPLDPNCVNFTTFITPVGRFCFNRLPFGVTSAPEIFQREMSKLLI 555


>UniRef50_Q4EA25 Cluster: Pol protein; n=1; Wolbachia endosymbiont
           of Drosophila ananassae|Rep: Pol protein - Wolbachia
           endosymbiont of Drosophila ananassae
          Length = 492

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 22/85 (25%), Positives = 51/85 (60%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ +    + I   KC F + E  FLG+ ++ +G +P  E++ ++    +P+ ++ +R F
Sbjct: 297 FKKLSKANLKIQINKCKFFSKETQFLGHVLTPEGVKPNPEKVNSILQLKIPRNIKQIRAF 356

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+  YYR+F+++ +++  PL+  +
Sbjct: 357 LGITGYYRKFIKDFSQVAYPLIKCL 381



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 30/51 (58%), Positives = 34/51 (66%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           TIDL K + QI V  +D  KTA  TP G YEFN M FGL+NA  TFQR I+
Sbjct: 211 TIDLAKGFHQILVQEQDREKTAFSTPHGHYEFNRMPFGLKNAPATFQRLIN 261



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           C  Y+DD+L++S    +H  H+ T+FK+L    +L IQ N C
Sbjct: 272 CVVYLDDVLIFSTSFSEHVGHIHTIFKKLS-KANLKIQINKC 312


>UniRef50_Q9ZVK4 Cluster: Putative retroelement pol polyprotein;
           n=1; Arabidopsis thaliana|Rep: Putative retroelement pol
           polyprotein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 1328

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 25/68 (36%), Positives = 42/68 (61%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F   E+ FLG+ +SA+G     E+I+A++D+  P     +R F+G+  YYRRF++ 
Sbjct: 653 SKCSFWQREMGFLGHIVSAEGVSVDPEKIEAIRDWHTPTNATEIRSFLGLAGYYRRFVKG 712

Query: 463 AAKLQAPL 486
            A +  P+
Sbjct: 713 FASMAQPM 720



 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/50 (46%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           IDL   Y  IP+A  D+ KTA  T +G +EF  M FGL NA   F R ++
Sbjct: 555 IDLTSGYHLIPIAEADVRKTAFRTRYGHFEFVVMPFGLTNAPAAFMRLMN 604



 Score = 36.7 bits (81), Expect = 0.52
 Identities = 15/44 (34%), Positives = 27/44 (61%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           +F   ++DDILVYS+   +H  HLR + ++L+  + L  + + C
Sbjct: 613 EFVIIFIDDILVYSKSLEEHEVHLRRVMEKLR-EQKLFAKLSKC 655



 Score = 35.9 bits (79), Expect = 0.91
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           P  W+PE EE F + K+ L+S  ++A P       ++TDAS   +G
Sbjct: 729 PFVWSPECEEGFVSLKEMLTSTPVLALPEHGEPYMVYTDASGVGLG 774


>UniRef50_Q7XNX7 Cluster: OSJNBb0026I12.3 protein; n=15;
           Magnoliophyta|Rep: OSJNBb0026I12.3 protein - Oryza
           sativa subsp. japonica (Rice)
          Length = 589

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 26/85 (30%), Positives = 47/85 (55%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           FQ  ++  +V+N  KC F   E   LG+R+S  G +    +I+ +   P P  ++G+R F
Sbjct: 144 FQRCQEKDLVLNWEKCHFMVHEGIVLGHRVSERGIEVDRAKIEVIDQLPPPVNIKGIRNF 203

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G   ++RRF++  + +  PL N +
Sbjct: 204 LGHAGFHRRFIKEFSTIARPLTNLL 228



 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 22/47 (46%), Positives = 29/47 (61%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    Y QIP+ P+D CKT    P+G Y +  M+FGL NA  +FQR
Sbjct: 59  LDGYSGYHQIPIHPKDQCKTTFTCPYGTYAYRRMSFGLCNAPASFQR 105


>UniRef50_Q5H9W5 Cluster: B1168G10.5 protein; n=4; Oryza sativa|Rep:
            B1168G10.5 protein - Oryza sativa (Rice)
          Length = 1456

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 25/86 (29%), Positives = 49/86 (56%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            + + + ++ +    +KC F   EV FLG+ ISA G       ++++ ++  P+TV  +R 
Sbjct: 909  ALEKLREHQLYAKFSKCEFWLSEVKFLGHVISAGGVAVDPSNVESVTNWKQPKTVSEIRS 968

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAI 498
            F+G+  YY+RF+ N +K+  P+   +
Sbjct: 969  FLGLAGYYQRFIENFSKIAKPMTRLL 994



 Score = 42.7 bits (96), Expect = 0.008
 Identities = 21/51 (41%), Positives = 29/51 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T + L+E   M+FGL NA   F   +++
Sbjct: 825 IDLRSGYHQLRINEEDIPKTAFTTRYELFECTVMSFGLTNAPAFFMNLMNK 875



 Score = 36.3 bits (80), Expect = 0.69
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YSR   +H  HLR   ++L+
Sbjct: 873 MNKVFMEYLDKFVVVFIDDILIYSRTKEEHEEHLRLALEKLR 914


>UniRef50_Q53JF2 Cluster: Retrotransposon protein, putative,
           Ty3-gypsy sub-class; n=2; Oryza sativa (japonica
           cultivar-group)|Rep: Retrotransposon protein, putative,
           Ty3-gypsy sub-class - Oryza sativa subsp. japonica
           (Rice)
          Length = 689

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 26/88 (29%), Positives = 50/88 (56%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + ++++ +  N +KC F   EV FLG+ ++A G       ++++  +  P+TV  +R F+
Sbjct: 586 EKLKEHQLYANFSKCDFWLKEVQFLGHVVNARGVAVDPANVESVTKWTPPRTVTQIRSFL 645

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAIVATE 510
           G+  YYRRF+ N +K+  P+   +   E
Sbjct: 646 GLAGYYRRFIENFSKIAKPMTQLLKKEE 673



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 20/49 (40%), Positives = 28/49 (57%)
 Frame = +3

Query: 12  LVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           L   Y Q+ +  EDI KTA I  +GL+E   M+FGL NA   F   +++
Sbjct: 502 LRSGYHQLRIRKEDIPKTAFIIRYGLFECTVMSFGLTNAPAFFMNLMNK 550



 Score = 37.5 bits (83), Expect = 0.30
 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YS+   +H  HLR + ++LK
Sbjct: 548 MNKVFMEFLDKFVVVFIDDILIYSKSEEEHEQHLRLVLEKLK 589


>UniRef50_A5BJ88 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1367

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 30/106 (28%), Positives = 57/106 (53%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           +V+N  KC F   +   LG+ IS  G +   E+ + +   P P TV+G+R+F+G V +Y+
Sbjct: 583 LVLNWDKCHFMVHQGIVLGHIISKQGIEVDKEKFELIVKLPSPTTVKGVRQFLGHVGFYK 642

Query: 448 RFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNALMPVKIACH 585
           RF+ + +KL  P    +   E+K+   +   + + N  +  ++ C+
Sbjct: 643 RFITDFSKLARPFCELLSFEELKLFLTTAPIVRAPNWQLSFEVMCN 688



 Score = 40.3 bits (90), Expect = 0.042
 Identities = 22/49 (44%), Positives = 25/49 (51%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +D    Y QI +  ED  KT    PFG Y +  M F L NA  TFQR I
Sbjct: 490 LDGYSRYFQIDIDVEDQEKTTFTCPFGTYTYRRMPFDLCNAPATFQRCI 538


>UniRef50_A5BC35 Cluster: Putative uncharacterized protein; n=5;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 870

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 26/49 (53%), Positives = 35/49 (71%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +D    Y QIP++P+D  KTA ITP GLY +  M+FGL+NAG T+QR +
Sbjct: 110 LDAFSGYHQIPMSPDDKEKTAFITPHGLYCYKVMSFGLKNAGATYQRLM 158



 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 21/65 (32%), Positives = 37/65 (56%)
 Frame = +1

Query: 262 YGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNY 441
           YG+ +NP+KC FG     FLG  +S  G +   ++++A+ + P P+  + L+R  G +  
Sbjct: 179 YGMKLNPSKCAFGVSAGKFLGFMVSQRGIEVSPDQVKAVMETPPPRNKKELQRLTGKLVA 238

Query: 442 YRRFL 456
             RF+
Sbjct: 239 LGRFI 243


>UniRef50_A5AFF2 Cluster: Putative uncharacterized protein; n=3; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1769

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F+ I  + +++NP KC FG      LG+ +S  G +   E+I+A+ D P P+T + +R F
Sbjct: 1089 FERIRQFRLILNPKKCTFGVTSGKLLGHIVSERGIEVDPEKIRAILDMPTPRTEKEIRGF 1148

Query: 424  IGMVNYYRRFLRNAAKLQAPL 486
            +G + +  RF+     +  P+
Sbjct: 1149 LGRLQHISRFIARLTDICEPI 1169



 Score = 49.6 bits (113), Expect = 7e-05
 Identities = 21/39 (53%), Positives = 30/39 (76%)
 Frame = +3

Query: 30   QIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
            +I +APED+ KT+ IT +G+Y +  M FGL+NAG T+QR
Sbjct: 1012 KILMAPEDMVKTSFITEWGIYCYQVMPFGLKNAGATYQR 1050


>UniRef50_Q9BK97 Cluster: Reverse transcriptase-like protein; n=2;
           Metazoa|Rep: Reverse transcriptase-like protein -
           Axinella corrugata (Marine sponge) (Teichaxinella
           morchella)
          Length = 143

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 30/74 (40%), Positives = 40/74 (54%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G  +NP KC FG  ++ FLG+ I   G     E+  A+ +   P  V  LRRF+GMVN  
Sbjct: 7   GATLNPDKCEFGKTKLKFLGHLIDESGIHADPEKTSAIVEMRPPGNVSELRRFMGMVNQL 66

Query: 445 RRFLRNAAKLQAPL 486
            +F  N A+L  PL
Sbjct: 67  GKFTPNLAELTQPL 80


>UniRef50_Q9HFY7 Cluster: Pol protein; n=1; Glomerella
           cingulata|Rep: Pol protein - Colletotrichum
           gloeosporioides (Anthracnose fungus)
           (Glomerellacingulata)
          Length = 1241

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 23/82 (28%), Positives = 52/82 (63%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           QA+++  +++ P K  F A EV +LG  I+        +++++++++P P  ++ ++ F+
Sbjct: 473 QALQNAKLLVEPEKSKFHAQEVEYLGFTITPGHIHMSKDKVRSIQEWPTPTNLKEVQSFL 532

Query: 427 GMVNYYRRFLRNAAKLQAPLVN 492
           G+VN+YR+F++   K+  PL +
Sbjct: 533 GLVNFYRKFIKYYGKINTPLTD 554



 Score = 37.5 bits (83), Expect = 0.30
 Identities = 21/51 (41%), Positives = 28/51 (54%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL  AY  I +   +  KTA  T  G +E+  M FGL NA  TFQ  I++
Sbjct: 387 LDLKGAYNLIRMKEGEEWKTAFRTRKGHFEYLVMPFGLTNAPATFQNMINQ 437


>UniRef50_Q2H2Q7 Cluster: Putative uncharacterized protein; n=1;
            Chaetomium globosum|Rep: Putative uncharacterized protein
            - Chaetomium globosum (Soil fungus)
          Length = 1892

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 24/82 (29%), Positives = 48/82 (58%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            + +  ++INP KCV+   +V +LG  ISA G Q   +++  + ++  P  ++  +  +G 
Sbjct: 1167 LRENNLIINPKKCVWNQMQVEYLGYIISAAGIQMSKKKVDCITNWAAPTNLKECQSSVGF 1226

Query: 433  VNYYRRFLRNAAKLQAPLVNAI 498
             N+YRRF+ N + +  PL +++
Sbjct: 1227 ANFYRRFINNFSAIARPLTSSL 1248



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQ 143
            +D+      I V   +  KTA    +GL+EF  M FG+ NA  TFQ
Sbjct: 1079 LDMKSGLNLIRVKEGNEWKTAFRCRYGLFEFTVMHFGMTNAPATFQ 1124



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = +3

Query: 534  WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            WTP ++E F   K + ++A ++AH  P  +  + TDA    +GA
Sbjct: 1256 WTPSMKEAFTQLKVAFATAPILAHHDPARQCIVGTDALDFAIGA 1299


>UniRef50_A6SRY0 Cluster: Putative uncharacterized protein; n=11;
            Sclerotiniaceae|Rep: Putative uncharacterized protein -
            Botryotinia fuckeliana B05.10
          Length = 1618

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 23/80 (28%), Positives = 49/80 (61%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            +++    ++  P+KC F   E  FLG  +S+ G +   ++++A+ ++  P T++ ++ F+
Sbjct: 839  ESLSKADLLCKPSKCEFHVTETEFLGFTVSSQGLKMSKDKVKAVLEWKQPTTIKEVQSFL 898

Query: 427  GMVNYYRRFLRNAAKLQAPL 486
            G VN+YRRF++  + +  PL
Sbjct: 899  GFVNFYRRFIKGYSGITTPL 918



 Score = 41.9 bits (94), Expect = 0.014
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL   Y  I +   +  KTA  T +GLYE+  M FGL NA  TF R ++
Sbjct: 753 MDLRNGYHLIRMKEGEEWKTAFKTRYGLYEYQVMPFGLTNAPATFMRLMN 802



 Score = 33.5 bits (73), Expect = 4.8
 Identities = 15/42 (35%), Positives = 24/42 (57%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           C  Y+DDILVYS + +QH   +  + + L   + LL + + C
Sbjct: 813 CICYLDDILVYSNNKVQHIKDVSNILESLSKAD-LLCKPSKC 853


>UniRef50_A5E738 Cluster: Putative uncharacterized protein; n=7;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 1262

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 29/92 (31%), Positives = 49/92 (53%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+A          +KC  G  +VTFLG+ +   GT+ P  +++ +K    P   + +R  
Sbjct: 480 FEAFRRNKFFFKGSKCELGVSKVTFLGHEVGQKGTRIPEVQLEVIKAIKTPDNPKDMRSA 539

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKV 519
           +G  NY+R +++N +K+ APL     AT+ KV
Sbjct: 540 LGFFNYFRHYIQNFSKIAAPLYE--YATKRKV 569


>UniRef50_Q7XVW4 Cluster: OSJNBa0065J03.7 protein; n=3; Oryza sativa
           (japonica cultivar-group)|Rep: OSJNBa0065J03.7 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 1414

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 24/84 (28%), Positives = 47/84 (55%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D+   +  +KC F   E+ +LG+ I   G      ++Q + ++ +P T++ LR F+
Sbjct: 708 QLLQDHQWKVKLSKCSFALKELNYLGHTIGVAGVSTDPSKVQDIVNWAIPTTLKKLRGFL 767

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           G+  YY +F++N   +  PL N +
Sbjct: 768 GIAGYYHKFVKNFGVISKPLTNLL 791



 Score = 41.5 bits (93), Expect = 0.018
 Identities = 23/58 (39%), Positives = 31/58 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +DL   Y QI +   +  KTA  T FG +E+  M+FGL  A  TFQ  ++E     LR
Sbjct: 622 LDLRAGYHQIRLVAGEEPKTAFQTHFGHFEYRVMSFGLTGALATFQGAMNETLASVLR 679



 Score = 34.7 bits (76), Expect = 2.1
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WTPE+ E F   K +L+SA ++A P       + TDAS   +GA  ++
Sbjct: 799 WTPEVHESFEQFKKALASAPVLALPDFTKPSVIETDASEIGIGAVLSQ 846


>UniRef50_Q7XLS5 Cluster: OSJNBa0057M08.11 protein; n=15; Oryza
            sativa|Rep: OSJNBa0057M08.11 protein - Oryza sativa
            (Rice)
          Length = 1664

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 25/86 (29%), Positives = 48/86 (55%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            + + + ++ +    +KC F   EV FLG+ ISA G       ++++ ++  P+TV  +  
Sbjct: 1187 ALEKLREHQLYAKFSKCEFWLSEVKFLGHVISAGGVAVDPSNVESVTNWKQPKTVSEIHS 1246

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAI 498
            F+G+  YYRRF+ N +K+  P+   +
Sbjct: 1247 FLGLAGYYRRFIENFSKIAKPMTRLL 1272



 Score = 43.2 bits (97), Expect = 0.006
 Identities = 21/51 (41%), Positives = 29/51 (56%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            IDL   Y Q+ +  EDI KTA  T + L+E   M+FGL NA   F   +++
Sbjct: 1103 IDLRSGYHQLRIKEEDIPKTAFTTRYRLFECTVMSFGLTNAPAFFMNLMNK 1153



 Score = 33.1 bits (72), Expect = 6.4
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137  VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            ++K++    D F   ++DDIL+YSR   +H  HL    ++L+
Sbjct: 1151 MNKVFMEYLDKFVVVFIDDILIYSRTKEEHEEHLCLALEKLR 1192


>UniRef50_Q75G97 Cluster: Putative uncharacterized protein
           OSJNBa0042F15.18; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           OSJNBa0042F15.18 - Oryza sativa subsp. japonica (Rice)
          Length = 915

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 27/80 (33%), Positives = 43/80 (53%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +E+  +VI   KC FG  EV +L + IS  G      ++  +  + +P  V  LR+F+
Sbjct: 356 QVLEENNLVIRLKKCAFGLSEVAYLVHIISKKGVATDPRKVDKITGWSIPTDVTELRKFL 415

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           GM  YYRRF++    +  P+
Sbjct: 416 GMTGYYRRFIKGYGLICRPM 435


>UniRef50_Q01HB3 Cluster: OSIGBa0139N19-OSIGBa0137L10.2 protein; n=11;
            Oryza sativa|Rep: OSIGBa0139N19-OSIGBa0137L10.2 protein -
            Oryza sativa (Rice)
          Length = 1680

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 25/84 (29%), Positives = 48/84 (57%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            + + D+ +    +KC F    V FLG+ IS++G +    +++A+  +  P+ V  +R F+
Sbjct: 1067 EKLRDHQLFAKFSKCEFWLDRVAFLGHVISSNGVEVDPSKVEAVLAWNPPKNVSEIRSFL 1126

Query: 427  GMVNYYRRFLRNAAKLQAPLVNAI 498
            G+  YYRRF+   +KL  P++  +
Sbjct: 1127 GLAGYYRRFIEGLSKLARPMIELL 1150



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            IDL   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 981  IDLRSGYHQLKIRSEDIPKTAFSTRYGLYEFTVMSFGLTNAPAFFMNLMNK 1031



 Score = 39.5 bits (88), Expect = 0.074
 Identities = 16/42 (38%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137  VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            ++KI+    D F   ++DDIL+YS++  +HA HLR + ++L+
Sbjct: 1029 MNKIFMEYQDQFVVVFIDDILIYSKNEEEHAEHLRLIMEKLR 1070


>UniRef50_A5B0B1 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 1192

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 28/98 (28%), Positives = 51/98 (52%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ I  + + +NP KC+FG      LG+ +S  G +   ++I+A+ D  +P+T + +R F
Sbjct: 651 FERIRKFRLKLNPKKCIFGVTSGKLLGHMVSERGIKVDLDKIKAILDMLVPRTEKEIRGF 710

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLG 537
           +G + Y  RF+     +  P     +   + VS  +LG
Sbjct: 711 LGRLQYISRFIARLIDILPPTSGRPLLLHLSVSDMTLG 748


>UniRef50_A5AKS9 Cluster: Putative uncharacterized protein; n=1; Vitis
            vinifera|Rep: Putative uncharacterized protein - Vitis
            vinifera (Grape)
          Length = 1571

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 27/78 (34%), Positives = 47/78 (60%)
 Frame = +1

Query: 268  IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
            +V+N  KC F   +   LG+ IS +G +   E+++ +   P P  V+ +R+F+G V +YR
Sbjct: 786  LVLNWEKCHFMVHQGIVLGHNISKEGIEVDKEKVELIVKLPSPTKVKEVRQFLGHVGFYR 845

Query: 448  RFLRNAAKLQAPLVNAIV 501
            RF+++ +KL  PL   +V
Sbjct: 846  RFIKDFSKLARPLCELLV 863



 Score = 40.3 bits (90), Expect = 0.042
 Identities = 21/47 (44%), Positives = 25/47 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    Y QI +  ED  KT    PF  Y +  M+FGL NA  TFQR
Sbjct: 693 LDGYSGYFQIEIDVEDQEKTTFTCPFRTYAYRRMSFGLCNAPATFQR 739


>UniRef50_A2Q2J0 Cluster: RNA-directed DNA polymerase (Reverse
           transcriptase); Ribonuclease H; n=39; core
           eudicotyledons|Rep: RNA-directed DNA polymerase (Reverse
           transcriptase); Ribonuclease H - Medicago truncatula
           (Barrel medic)
          Length = 1146

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ +  Y + +NP KC FG      LG  +S  G +   ++++A+++ P PQT + +R F
Sbjct: 305 FERLRKYKLRLNPNKCTFGVRSGKLLGFIVSQKGIEVDPDKVRAIREMPAPQTEKQVRGF 364

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +G +NY  RF+ +      P+
Sbjct: 365 LGRLNYISRFISHMTATCGPI 385



 Score = 50.0 bits (114), Expect = 5e-05
 Identities = 23/47 (48%), Positives = 31/47 (65%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    Y QI ++PED  KT+ ITP+G + +  M FGL NAG T+QR
Sbjct: 220 MDGFSGYNQIKMSPEDREKTSFITPWGTFCYKVMPFGLINAGATYQR 266



 Score = 33.1 bits (72), Expect = 6.4
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           YVDD++V S D  QH  +L  +F+RL+    L +  N C
Sbjct: 283 YVDDMIVKSADEEQHVEYLTKMFERLR-KYKLRLNPNKC 320


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 629,943,701
Number of Sequences: 1657284
Number of extensions: 12043272
Number of successful extensions: 33312
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 30231
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33206
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 52479343733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -