SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120006.Seq
         (617 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P62913 Cluster: 60S ribosomal protein L11; n=156; Eukar...   153   3e-36
UniRef50_UPI000155375A Cluster: PREDICTED: similar to ribosomal ...   150   3e-35
UniRef50_P0C0W9 Cluster: 60S ribosomal protein L11-A; n=25; Euka...   134   1e-30
UniRef50_P42794 Cluster: 60S ribosomal protein L11-2; n=38; Euka...   129   6e-29
UniRef50_A0DI11 Cluster: Chromosome undetermined scaffold_51, wh...   112   7e-24
UniRef50_UPI00015BB1AB Cluster: LSU ribosomal protein L5P; n=1; ...    83   7e-15
UniRef50_Q9YF87 Cluster: 50S ribosomal protein L5P; n=20; Archae...    81   2e-14
UniRef50_O28367 Cluster: 50S ribosomal protein L5P; n=1; Archaeo...    81   2e-14
UniRef50_Q46GA8 Cluster: 50S ribosomal protein L5P; n=3; Methano...    79   1e-13
UniRef50_A3H987 Cluster: Ribosomal protein L5; n=1; Caldivirga m...    78   1e-13
UniRef50_Q673R5 Cluster: Ribosomal protein L5/L11; n=2; environm...    78   2e-13
UniRef50_A5UL75 Cluster: Ribosomal protein L5p; n=1; Methanobrev...    77   3e-13
UniRef50_Q74N79 Cluster: 50S ribosomal protein L5P; n=1; Nanoarc...    77   4e-13
UniRef50_Q8PV37 Cluster: 50S ribosomal protein L5P; n=6; Methano...    77   4e-13
UniRef50_A0RVY6 Cluster: Ribosomal protein L5; n=1; Cenarchaeum ...    73   6e-12
UniRef50_P14124 Cluster: 50S ribosomal protein L5P; n=5; Halobac...    71   2e-11
UniRef50_A7DSY1 Cluster: Ribosomal protein L5; n=1; Candidatus N...    69   7e-11
UniRef50_Q6L1B4 Cluster: 50S ribosomal protein L5P; n=4; Thermop...    69   1e-10
UniRef50_Q6LXE0 Cluster: 50S ribosomal protein L5P; n=7; Euryarc...    67   3e-10
UniRef50_Q6CKT5 Cluster: Similarity; n=1; Kluyveromyces lactis|R...    60   4e-08
UniRef50_Q3LWF5 Cluster: Ribosomal protein L11; n=1; Bigelowiell...    56   7e-07
UniRef50_Q01C63 Cluster: Chromosome 03 contig 1, DNA sequence; n...    51   3e-05
UniRef50_Q7VQD6 Cluster: 50S ribosomal protein L5; n=4; Bacteria...    47   3e-04
UniRef50_P38517 Cluster: 50S ribosomal protein L5; n=18; cellula...    46   7e-04
UniRef50_Q9HWE7 Cluster: 50S ribosomal protein L5; n=187; Bacter...    46   0.001
UniRef50_A6PPX3 Cluster: 50S ribosomal protein L5; n=1; Victival...    45   0.002
UniRef50_Q9G893 Cluster: Ribosomal protein L5; n=1; Malawimonas ...    44   0.003
UniRef50_Q7R5U0 Cluster: GLP_81_173473_174138; n=1; Giardia lamb...    42   0.009
UniRef50_A3GUR6 Cluster: 50S ribosomal protein L5; n=1; Vibrio c...    41   0.027
UniRef50_A5CCK0 Cluster: 50S ribosomal protein L5; n=1; Orientia...    39   0.083
UniRef50_O04603 Cluster: 50S ribosomal protein L5, chloroplast p...    38   0.14 
UniRef50_Q6A6N8 Cluster: 50S ribosomal protein L5; n=125; Bacter...    37   0.33 
UniRef50_Q9MAT2 Cluster: F13M7.17; n=1; Arabidopsis thaliana|Rep...    37   0.44 
UniRef50_P73308 Cluster: 50S ribosomal protein L5; n=227; cellul...    36   1.0  
UniRef50_Q6B8W5 Cluster: Chloroplast 50S ribosomal protein L5; n...    35   1.8  
UniRef50_O21252 Cluster: Mitochondrial 60S ribosomal protein L5;...    34   2.4  
UniRef50_P46749 Cluster: Mitochondrial 60S ribosomal protein L5;...    34   3.1  
UniRef50_Q11UJ1 Cluster: Endoglucanase, glycoside hydrolase fami...    33   4.1  
UniRef50_A6D0I6 Cluster: Putative uncharacterized protein; n=1; ...    33   5.5  
UniRef50_A0RPV7 Cluster: Wbgx protein; n=3; Campylobacter|Rep: W...    33   7.2  
UniRef50_Q4FLN0 Cluster: 50S ribosomal protein L5; n=3; Bacteria...    33   7.2  
UniRef50_A0UYZ7 Cluster: FolC bifunctional protein; n=1; Clostri...    32   9.5  
UniRef50_Q61E12 Cluster: Putative uncharacterized protein CBG122...    32   9.5  
UniRef50_A4HFL7 Cluster: Putative uncharacterized protein; n=3; ...    32   9.5  
UniRef50_Q30TV2 Cluster: 50S ribosomal protein L5; n=2; Epsilonp...    32   9.5  

>UniRef50_P62913 Cluster: 60S ribosomal protein L11; n=156;
           Eukaryota|Rep: 60S ribosomal protein L11 - Homo sapiens
           (Human)
          Length = 178

 Score =  153 bits (371), Expect = 3e-36
 Identities = 68/84 (80%), Positives = 79/84 (94%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILE+GLKVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR
Sbjct: 77  AKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 136

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PGF++A ++R+TG +G  HR++KE
Sbjct: 137 PGFSIADKKRRTGCIGAKHRISKE 160



 Score =  132 bits (320), Expect = 5e-30
 Identities = 64/79 (81%), Positives = 68/79 (86%)
 Frame = +2

Query: 41  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRR 220
           +   +N MR L IRKLCLNICVGESGDRLTRAAKVLEQLTGQ PVFSKARYTVRSFGIRR
Sbjct: 5   QGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRR 64

Query: 221 NEKIAVHCTVRELKQKKSL 277
           NEKIAVHCTVR  K ++ L
Sbjct: 65  NEKIAVHCTVRGAKAEEIL 83


>UniRef50_UPI000155375A Cluster: PREDICTED: similar to ribosomal
           protein L11; n=1; Mus musculus|Rep: PREDICTED: similar
           to ribosomal protein L11 - Mus musculus
          Length = 279

 Score =  150 bits (363), Expect = 3e-35
 Identities = 67/84 (79%), Positives = 78/84 (92%)
 Frame = +1

Query: 256 AKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 435
           AKAEEILE+GLKVREYELR++NFS TGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR
Sbjct: 131 AKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGR 190

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
            GF++A ++R+TG +G  HR++KE
Sbjct: 191 SGFSIADKKRRTGCIGAKHRISKE 214



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 31/40 (77%), Positives = 34/40 (85%)
 Frame = +2

Query: 158 TGQQPVFSKARYTVRSFGIRRNEKIAVHCTVRELKQKKSL 277
           +GQ PV SKARYTVRSFGIRRNEKIAVHCTVR  K ++ L
Sbjct: 98  SGQAPVESKARYTVRSFGIRRNEKIAVHCTVRGAKAEEIL 137


>UniRef50_P0C0W9 Cluster: 60S ribosomal protein L11-A; n=25;
           Eukaryota|Rep: 60S ribosomal protein L11-A -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 174

 Score =  134 bits (325), Expect = 1e-30
 Identities = 62/83 (74%), Positives = 69/83 (83%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRP 438
           KAEEILERGLKV+EY+LR  NFSATGNFGFGI EHIDLGIKYDPSIGI+G+DFYVV+ RP
Sbjct: 75  KAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHIDLGIKYDPSIGIFGMDFYVVMNRP 134

Query: 439 GFNVAHRRRKTGKVGFPHRLTKE 507
           G  V  R+R  G VG  H+ TKE
Sbjct: 135 GARVTRRKRCKGTVGNSHKTTKE 157



 Score =  110 bits (265), Expect = 2e-23
 Identities = 58/80 (72%), Positives = 67/80 (83%), Gaps = 1/80 (1%)
 Frame = +2

Query: 50  SKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEK 229
           ++N MR+L I KL LNI VGESGDRLTRA+KVLEQL+GQ PV SKARYTVR+FGIRRNEK
Sbjct: 5   AQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIRRNEK 64

Query: 230 IAVHCTVRELKQKKSL-RGV 286
           IAVH TVR  K ++ L RG+
Sbjct: 65  IAVHVTVRGPKAEEILERGL 84


>UniRef50_P42794 Cluster: 60S ribosomal protein L11-2; n=38;
           Eukaryota|Rep: 60S ribosomal protein L11-2 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 182

 Score =  129 bits (311), Expect = 6e-29
 Identities = 60/83 (72%), Positives = 68/83 (81%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRP 438
           KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DFYVVL RP
Sbjct: 77  KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERP 136

Query: 439 GFNVAHRRRKTGKVGFPHRLTKE 507
           G+ VA RRR   +VG  HR+TK+
Sbjct: 137 GYRVARRRRCKTRVGIQHRVTKD 159



 Score =  110 bits (265), Expect = 2e-23
 Identities = 56/80 (70%), Positives = 64/80 (80%)
 Frame = +2

Query: 38  SEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIR 217
           SE    N MR++ ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIR
Sbjct: 3   SEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIR 62

Query: 218 RNEKIAVHCTVRELKQKKSL 277
           RNEKIA + TVR  K  + L
Sbjct: 63  RNEKIACYVTVRGEKAMQLL 82


>UniRef50_A0DI11 Cluster: Chromosome undetermined scaffold_51, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_51,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 197

 Score =  112 bits (269), Expect = 7e-24
 Identities = 50/71 (70%), Positives = 61/71 (85%)
 Frame = +2

Query: 41  EDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRR 220
           ++  +NVMR + I KL ++IC GESGD+LT+AAKVLE LTGQ+PVF KARYTVRSFGIRR
Sbjct: 32  QETKENVMRKIRIEKLMVHICAGESGDKLTKAAKVLEDLTGQKPVFGKARYTVRSFGIRR 91

Query: 221 NEKIAVHCTVR 253
           NEKI+V CT+R
Sbjct: 92  NEKISVFCTIR 102



 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 36/75 (48%), Positives = 50/75 (66%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRP 438
           +A +IL RGL+V+E EL++ NFS +GNFGFGIQEHIDLG+KYDP  GI+       + + 
Sbjct: 105 QARDILVRGLRVKEMELKKRNFSESGNFGFGIQEHIDLGLKYDPYTGIFRYGLLCCVVKT 164

Query: 439 GFNVAHRRRKTGKVG 483
                 ++ K  K+G
Sbjct: 165 RIESCSKKIKKFKIG 179


>UniRef50_UPI00015BB1AB Cluster: LSU ribosomal protein L5P; n=1;
           Ignicoccus hospitalis KIN4/I|Rep: LSU ribosomal protein
           L5P - Ignicoccus hospitalis KIN4/I
          Length = 198

 Score = 82.6 bits (195), Expect = 7e-15
 Identities = 36/84 (42%), Positives = 56/84 (66%), Gaps = 1/84 (1%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVVLGR 435
           +A E L++ L+   ++++  +F   GN GFGI+EHI + G +YDP +GI+G+D  + + R
Sbjct: 99  RAVEFLKKALEAVGWKIKASSFDEFGNVGFGIREHIQIPGTRYDPRVGIFGMDVILTIER 158

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PG+ VA RRR   K+   HR+TKE
Sbjct: 159 PGYRVARRRRARSKIPRRHRVTKE 182



 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 33/59 (55%), Positives = 45/59 (76%)
 Frame = +2

Query: 77  IRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVHCTVR 253
           + K+ +NI +GESG+RL +A  +LE+LTGQ+PV  KA+ T+R FGIRR E IAV  T+R
Sbjct: 38  LAKVTVNIALGESGERLEKAYNLLEELTGQRPVKRKAKKTIRQFGIRRGENIAVMVTLR 96


>UniRef50_Q9YF87 Cluster: 50S ribosomal protein L5P; n=20;
           Archaea|Rep: 50S ribosomal protein L5P - Aeropyrum
           pernix
          Length = 192

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 39/76 (51%), Positives = 56/76 (73%)
 Frame = +2

Query: 53  KNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKI 232
           ++ MR   I K+ +NI +G+SG+RL RAA+VLE+LTGQ+PVF KA+ T+R+FG+R+ E I
Sbjct: 24  RSPMRRPRIVKVTVNISIGQSGERLQRAAEVLEELTGQKPVFRKAKRTIRAFGVRKGENI 83

Query: 233 AVHCTVRELKQKKSLR 280
           AV  T+R  K    L+
Sbjct: 84  AVMVTLRGEKALNFLK 99



 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 33/85 (38%), Positives = 50/85 (58%), Gaps = 2/85 (2%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVVLGR 435
           KA   L+R L    + ++  +    GN  FGI+EHI + G+KYDP +GI G+D  + + R
Sbjct: 93  KALNFLKRALDAVGHRIKTSSIDEHGNVSFGIEEHILIPGVKYDPRVGILGMDVAITIQR 152

Query: 436 PGFNVAHRRR-KTGKVGFPHRLTKE 507
           PG  +  RRR + G +   HR+T+E
Sbjct: 153 PGHRIVERRRQRRGHIPRRHRVTRE 177


>UniRef50_O28367 Cluster: 50S ribosomal protein L5P; n=1;
           Archaeoglobus fulgidus|Rep: 50S ribosomal protein L5P -
           Archaeoglobus fulgidus
          Length = 178

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVVLGR 435
           KA + L+  L V+E  L R +    G F FGI EHIDL G+ YDP +GI+G+D  V L R
Sbjct: 82  KALKFLKDALTVKENRLSRKSIGE-GYFAFGIAEHIDLPGVDYDPDVGIFGMDVCVSLKR 140

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
            G+ VA RRRK  K+   HR+TKE
Sbjct: 141 RGYRVARRRRKKAKIATSHRVTKE 164



 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 31/77 (40%), Positives = 51/77 (66%)
 Frame = +2

Query: 50  SKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEK 229
           ++N MR + + K+ +NI VGESG+R  +A  +LE+L  Q+P  + A+ T+++FGIR+ E 
Sbjct: 12  NENPMREVVLDKVVINIGVGESGERHKKAYSLLEELVEQKPAITYAKMTIKNFGIRKGEA 71

Query: 230 IAVHCTVRELKQKKSLR 280
           I +  T+R  K  K L+
Sbjct: 72  IGIKVTLRGEKALKFLK 88


>UniRef50_Q46GA8 Cluster: 50S ribosomal protein L5P; n=3;
           Methanomicrobia|Rep: 50S ribosomal protein L5P -
           Methanosarcina barkeri (strain Fusaro / DSM 804)
          Length = 169

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVVLGR 435
           +A++ LE  L + +  L R  F + GN  FGI+EH D  G+KYDP+IG++G+D  VV+ R
Sbjct: 71  RAQQFLETALGIVDKTLVRSQFDSLGNVSFGIEEHTDFPGMKYDPNIGVFGMDVTVVIKR 130

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PG  +  RR  T K+   HR+T E
Sbjct: 131 PGERICKRRIATRKIPTNHRVTLE 154



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 27/74 (36%), Positives = 45/74 (60%)
 Frame = +2

Query: 56  NVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIA 235
           NVMR   + K+ +++ VGESG  L  A ++L  +TGQ+ V   A+ T+ +F I++NE I 
Sbjct: 3   NVMRTPVVEKVIVHMGVGESGQHLVDAEEILRNITGQEVVRCFAKRTLPAFSIKKNEPIG 62

Query: 236 VHCTVRELKQKKSL 277
              T+R  + ++ L
Sbjct: 63  CKVTLRGQRAQQFL 76


>UniRef50_A3H987 Cluster: Ribosomal protein L5; n=1; Caldivirga
           maquilingensis IC-167|Rep: Ribosomal protein L5 -
           Caldivirga maquilingensis IC-167
          Length = 197

 Score = 78.2 bits (184), Expect = 1e-13
 Identities = 40/86 (46%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 RAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVVL 429
           R +A   L R L   ++ LR ++F+A GN  FGI+EHI + G +YDP++GI+G D  V L
Sbjct: 96  RNEAVWFLLRALAAVDFTLREESFNA-GNVSFGIREHILVPGSRYDPALGIFGFDVAVTL 154

Query: 430 GRPGFNVAHRRRKTGKVGFPHRLTKE 507
            RPGF V +RRR    VG  HR+++E
Sbjct: 155 ARPGFRVQYRRRARADVGKDHRVSRE 180



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/64 (42%), Positives = 44/64 (68%)
 Frame = +2

Query: 62  MRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVH 241
           MR + I  + +N+ +G+SG+RL +AAKV+ +LTG+ P +  A  +++ FGIRR E I + 
Sbjct: 32  MRRIFIWSVAVNMGIGQSGERLEKAAKVMSELTGRTPSYRLAHKSIKDFGIRRGEPIGLL 91

Query: 242 CTVR 253
            T+R
Sbjct: 92  VTLR 95


>UniRef50_Q673R5 Cluster: Ribosomal protein L5/L11; n=2;
           environmental samples|Rep: Ribosomal protein L5/L11 -
           uncultured marine group II euryarchaeote DeepAnt-JyKC7
          Length = 168

 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 40/84 (47%), Positives = 50/84 (59%), Gaps = 1/84 (1%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGI-KYDPSIGIYGLDFYVVLGR 435
           K +  L+    VRE  L   NF  +GN  FGI ++ D    KYDP IGIYG+D  VVL R
Sbjct: 68  KVQSFLKDAFWVRENTLPSYNFDQSGNLSFGIADYTDFPAQKYDPDIGIYGMDVNVVLER 127

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
           PG  V+ RRR+  KVG  HR+ K+
Sbjct: 128 PGHRVSRRRRRGVKVGVEHRVGKD 151



 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 27/66 (40%), Positives = 38/66 (57%)
 Frame = +2

Query: 77  IRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVHCTVRE 256
           I K+ +NI VGE G RL  A +VLE LTG +P+ + +R T R  G R    I    T+R+
Sbjct: 6   ITKVTVNIGVGEGGSRLQLAERVLELLTGLKPIRTISRMTNRDLGTRLGAPIGCKVTIRD 65

Query: 257 LKQKKS 274
             + +S
Sbjct: 66  ADKVQS 71


>UniRef50_A5UL75 Cluster: Ribosomal protein L5p; n=1;
           Methanobrevibacter smithii ATCC 35061|Rep: Ribosomal
           protein L5p - Methanobrevibacter smithii (strain PS /
           ATCC 35061 / DSM 861)
          Length = 170

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 1/107 (0%)
 Frame = +1

Query: 235 CPLYSPRAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGL 411
           C L     KA++ +E  L+     ++   F A GN  FGI+EHID+ G+KY+P IGI+G+
Sbjct: 62  CKLTLRGEKADKAIEMVLEGINKNIKPTQFDAQGNLSFGIKEHIDIPGMKYNPDIGIFGM 121

Query: 412 DFYVVLGRPGFNVAHRRRKTGKVGFPHRLTKEVL*SGSNRNMMVSYL 552
           +  V   +PG+ +A RR +  KV   HR++KE        N  V+Y+
Sbjct: 122 NVSVTFEKPGYRIAKRRIQQKKVPAKHRISKEETMKYMEDNFNVNYV 168



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 32/84 (38%), Positives = 50/84 (59%)
 Frame = +2

Query: 56  NVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIA 235
           N M  + I K  ++I VGE+G++L+RA  +LEQ+  Q PV + ++ T   FGIR+ + IA
Sbjct: 2   NPMNEVQISKATVSIGVGEAGEKLSRAITLLEQMFDQTPVKTFSKVTNPEFGIRKRQPIA 61

Query: 236 VHCTVRELKQKKSLRGV*KSENMN 307
              T+R  K  K++  V +  N N
Sbjct: 62  CKLTLRGEKADKAIEMVLEGINKN 85


>UniRef50_Q74N79 Cluster: 50S ribosomal protein L5P; n=1;
           Nanoarchaeum equitans|Rep: 50S ribosomal protein L5P -
           Nanoarchaeum equitans
          Length = 169

 Score = 76.6 bits (180), Expect = 4e-13
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +1

Query: 259 KAEEIL-ERGLKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVVLG 432
           KA +IL E+ L   +++++  +F+  G FGFGI E+I + G+KYDP +G+ GL+ YV L 
Sbjct: 71  KAYKILKEKLLPAVDFKIKASSFTDRG-FGFGIPEYIMIPGMKYDPELGLIGLEAYVTLE 129

Query: 433 RPGFNVAHRRRKTGKVGFPHRLTKE 507
           RPG+ V  RR K  KVG  HRL KE
Sbjct: 130 RPGYRVERRRIKRSKVGSRHRLNKE 154



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 33/73 (45%), Positives = 48/73 (65%)
 Frame = +2

Query: 62  MRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVH 241
           MR + I K+ LNI VGESG++L +A ++L++LTGQ+PV +KA+  V  + IR    I V 
Sbjct: 5   MRKIRIEKVTLNIGVGESGEKLDKAYELLKRLTGQKPVKTKAKVRVEQWHIRPGLPIGVK 64

Query: 242 CTVRELKQKKSLR 280
            T+R  K  K L+
Sbjct: 65  VTLRGEKAYKILK 77


>UniRef50_Q8PV37 Cluster: 50S ribosomal protein L5P; n=6;
           Methanomicrobia|Rep: 50S ribosomal protein L5P -
           Methanosarcina mazei (Methanosarcina frisia)
          Length = 169

 Score = 76.6 bits (180), Expect = 4e-13
 Identities = 36/82 (43%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVVLGR 435
           +A+E L    ++ E  L R  F + GN  FGI+EH D  G++YDP+IG++G+D  VVL R
Sbjct: 71  RAQEFLGTSFEIIEKTLSRAQFDSLGNVSFGIEEHTDFPGMRYDPNIGVFGMDVTVVLKR 130

Query: 436 PGFNVAHRRRKTGKVGFPHRLT 501
           PG  +  RR  T K+   HR+T
Sbjct: 131 PGERICKRRIATRKIPTDHRVT 152



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 26/74 (35%), Positives = 45/74 (60%)
 Frame = +2

Query: 56  NVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIA 235
           N MR   + K+ +++ VGESG  L  A ++L+ +TGQ+ V   A+ T+ +F I++NE I 
Sbjct: 3   NPMRTPMVEKVIVHMGVGESGQHLVNAEEILKTITGQEVVRCFAKRTLPAFSIKKNEPIG 62

Query: 236 VHCTVRELKQKKSL 277
              T+R  + ++ L
Sbjct: 63  CKVTLRGQRAQEFL 76


>UniRef50_A0RVY6 Cluster: Ribosomal protein L5; n=1; Cenarchaeum
           symbiosum|Rep: Ribosomal protein L5 - Cenarchaeum
           symbiosum
          Length = 169

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +1

Query: 262 AEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVVLGRP 438
           A  +  R  + +  +++  +F   GNF FGI EHID+ GIKYDP IGI GLD  + L RP
Sbjct: 72  AGALARRLFEAKGGQVKGRSFDDFGNFSFGIGEHIDIPGIKYDPGIGILGLDVCMTLSRP 131

Query: 439 GFNVAHRRRKTGKVGFPHRLT 501
           G+ +  R +   +VG  HR+T
Sbjct: 132 GYGIRKRSKHKARVGRSHRIT 152



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 23/64 (35%), Positives = 39/64 (60%)
 Frame = +2

Query: 62  MRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVH 241
           MR + + K+ LN+ VG+SG+ +  A + L +++G++P    A  T R FG+R+ E I   
Sbjct: 5   MRKITLEKVVLNMGVGQSGNAVEVAKRALGEISGKKPCGRDAHETQRDFGVRKGEPIGAA 64

Query: 242 CTVR 253
            T+R
Sbjct: 65  VTIR 68


>UniRef50_P14124 Cluster: 50S ribosomal protein L5P; n=5;
           Halobacteriaceae|Rep: 50S ribosomal protein L5P -
           Haloarcula marismortui (Halobacterium marismortui)
          Length = 177

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 38/80 (47%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +1

Query: 262 AEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVVLGRP 438
           AEE L+  L + E  L    F  TGNF FG++EH +    +YDPSIGIYGLD  V L RP
Sbjct: 81  AEEFLQTALPLAE--LATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRP 138

Query: 439 GFNVAHRRRKTGKVGFPHRL 498
           G+ VA R + +  +   HRL
Sbjct: 139 GYRVAKRDKASRSIPTKHRL 158



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 24/65 (36%), Positives = 37/65 (56%)
 Frame = +2

Query: 62  MRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVH 241
           MR   I K+ +++ +G  G  L  A  +L ++TGQ PV +KA+ TV  F IR  + I   
Sbjct: 14  MREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAK 73

Query: 242 CTVRE 256
            T+R+
Sbjct: 74  VTLRD 78


>UniRef50_A7DSY1 Cluster: Ribosomal protein L5; n=1; Candidatus
           Nitrosopumilus maritimus SCM1|Rep: Ribosomal protein L5
           - Candidatus Nitrosopumilus maritimus SCM1
          Length = 173

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 34/83 (40%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = +1

Query: 262 AEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVVLGRP 438
           A+ +L+R L+ +   +    F   GN+ FGI+EHID+ G+KY+PSIGI GL   V L RP
Sbjct: 76  AKALLKRLLEAKGNTVNGRAFDNFGNYSFGIREHIDIPGVKYEPSIGILGLGISVTLTRP 135

Query: 439 GFNVAHRRRKTGKVGFPHRLTKE 507
           G+ +  R +    VG  H +T +
Sbjct: 136 GYGIRTRSKHKASVGKSHIITSQ 158



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 25/68 (36%), Positives = 46/68 (67%)
 Frame = +2

Query: 50  SKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEK 229
           +++ M+ + + K+ LN+ VG+SGD +  A++ LEQ++G++P    A+ T R +G+R+ E 
Sbjct: 5   TESPMKKISLEKVVLNMGVGKSGDVIEIASRALEQISGKKPSARNAKETQRDWGVRKGEP 64

Query: 230 IAVHCTVR 253
           I V  T+R
Sbjct: 65  IGVAVTIR 72


>UniRef50_Q6L1B4 Cluster: 50S ribosomal protein L5P; n=4;
           Thermoplasmatales|Rep: 50S ribosomal protein L5P -
           Picrophilus torridus
          Length = 176

 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 34/71 (47%), Positives = 48/71 (67%)
 Frame = +2

Query: 44  DNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 223
           + ++N MR + I K+ +NI VG +G+RL RAAKVLE LT  +P F+ A+ TVR F IR+ 
Sbjct: 3   ETTENSMREIVIDKVVVNIGVGAAGERLNRAAKVLELLTHHKPAFTSAKRTVRDFNIRKG 62

Query: 224 EKIAVHCTVRE 256
             I V  T+R+
Sbjct: 63  LNIGVKVTLRK 73



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 29/84 (34%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +1

Query: 262 AEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVVL-GR 435
           A   L+     ++Y++   +F   GN  FGI ++ D  G+KYDP IGI+G+D  +V   R
Sbjct: 76  ALSFLKEAFYAKDYKIPVYSFDKNGNAYFGISDYTDFKGMKYDPDIGIFGMDIAIVFRRR 135

Query: 436 PGFNVAHRRRKTGKVGFPHRLTKE 507
            G+ +  RR K   +    R++KE
Sbjct: 136 GGYRIEKRRIKKMHIPKKMRISKE 159


>UniRef50_Q6LXE0 Cluster: 50S ribosomal protein L5P; n=7;
           Euryarchaeota|Rep: 50S ribosomal protein L5P -
           Methanococcus maripaludis
          Length = 181

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 36/87 (41%), Positives = 47/87 (54%), Gaps = 4/87 (4%)
 Frame = +1

Query: 259 KAEEILERGL---KVREYELRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVV 426
           KAEE L+      K     L   +F   GNF FG+ EHID  G KYDPS+GIYG+D  V 
Sbjct: 78  KAEEFLKNAFTAFKACGKTLFASSFDQVGNFSFGVPEHIDFPGQKYDPSVGIYGMDICVT 137

Query: 427 LGRPGFNVAHRRRKTGKVGFPHRLTKE 507
             + G+ V  R+ K   +   H +TK+
Sbjct: 138 FEKSGYRVKSRKVKRSHIPEKHLVTKD 164



 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 34/76 (44%), Positives = 50/76 (65%)
 Frame = +2

Query: 53  KNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKI 232
           K  M+   I+K+ +N  VGE+GDRLT  AKV+E+LTGQ PV + A+ T  +FGIR+   I
Sbjct: 9   KEPMKKPRIQKVTVNFGVGEAGDRLTIGAKVIEELTGQSPVRTLAKQTNPAFGIRKKLPI 68

Query: 233 AVHCTVRELKQKKSLR 280
            +  T+R  K ++ L+
Sbjct: 69  GLKVTLRGKKAEEFLK 84


>UniRef50_Q6CKT5 Cluster: Similarity; n=1; Kluyveromyces lactis|Rep:
           Similarity - Kluyveromyces lactis (Yeast) (Candida
           sphaerica)
          Length = 191

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 25/59 (42%), Positives = 40/59 (67%)
 Frame = -3

Query: 441 TWPAKYDVKVQSINSN*GIVLDTQVNVFLNTEAKITRGGEVVTPQFIFSDFQTPLKDFF 265
           TW    +V++ ++N++  +VLDTQ++VFL+TE ++T   EV   Q +F D QT  +DFF
Sbjct: 44  TWSTHDNVEIHTVNTDTWVVLDTQIDVFLDTETEVTGSREVSVSQLVFLDLQTSFQDFF 102



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 28/79 (35%), Positives = 46/79 (58%)
 Frame = -2

Query: 292 LSNPSQGFLLL*LSDCTMDSNLFITTDTKRPHCIPSLGKYRLLSCELLQHLGGTSQPVTG 113
           L    Q F  L  ++  +DSNLF+++DT+    + SLG    L+ +L Q+LG + Q VT 
Sbjct: 94  LQTSFQDFFSLWTTNSNVDSNLFVSSDTESSDSVSSLGLNWSLTRQLFQNLGSSGQSVTR 153

Query: 112 FTNTDVQAKLSDMKIPHYI 56
           FTN ++Q +  D++  H +
Sbjct: 154 FTNRNIQDQFLDLQFTHRV 172


>UniRef50_Q3LWF5 Cluster: Ribosomal protein L11; n=1; Bigelowiella
           natans|Rep: Ribosomal protein L11 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 139

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 23/68 (33%), Positives = 40/68 (58%)
 Frame = +1

Query: 274 LERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFNVA 453
           L + LK++ + +   NFS T  FG GI +H++LG  +D  IGI+G++    L R G+ + 
Sbjct: 72  LYKMLKLKTFTINESNFSLTSTFGIGISDHLELGYNFDQKIGIHGINIIGDLSRRGYRIK 131

Query: 454 HRRRKTGK 477
            ++ +  K
Sbjct: 132 LKKEQDPK 139


>UniRef50_Q01C63 Cluster: Chromosome 03 contig 1, DNA sequence; n=1;
           Ostreococcus tauri|Rep: Chromosome 03 contig 1, DNA
           sequence - Ostreococcus tauri
          Length = 363

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 22/63 (34%), Positives = 39/63 (61%)
 Frame = -2

Query: 232 NLFITTDTKRPHCIPSLGKYRLLSCELLQHLGGTSQPVTGFTNTDVQAKLSDMKIPHYIF 53
           +LF+T + +R H +  LG+ RLL+ +LLQHL    + +T   N +V+ +L +   PH + 
Sbjct: 144 DLFVTANAERAHGVARLGEDRLLTGQLLQHLRRLREAITALANANVEHELVNADRPHRVL 203

Query: 52  RII 44
           R++
Sbjct: 204 RLV 206



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 24/66 (36%), Positives = 41/66 (62%)
 Frame = -3

Query: 468 LTPSVCYVETWPAKYDVKVQSINSN*GIVLDTQVNVFLNTEAKITRGGEVVTPQFIFSDF 289
           LTP+V  V     ++DV++ +++    +VLD +VNVF +TE ++TRG EV   +F F   
Sbjct: 65  LTPAVDSVAR-ALQHDVEIHTVDPCGRVVLDAEVNVFADTETEVTRGAEVALEEFEFLHL 123

Query: 288 QTPLKD 271
           +  L++
Sbjct: 124 EPALQN 129


>UniRef50_Q7VQD6 Cluster: 50S ribosomal protein L5; n=4;
           Bacteria|Rep: 50S ribosomal protein L5 - Blochmannia
           floridanus
          Length = 190

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 27/70 (38%), Positives = 45/70 (64%), Gaps = 3/70 (4%)
 Frame = +2

Query: 53  KNVMRNLHIRKLCLNICVGES---GDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 223
           K+VM+   I K+ +++ VG+S      L RA + LE ++GQ+PV +KAR ++ SF IR+ 
Sbjct: 23  KSVMQVPKINKITISMGVGKSIINKKFLERAIEDLEMISGQKPVITKARKSIASFKIRQG 82

Query: 224 EKIAVHCTVR 253
           ++I    T+R
Sbjct: 83  QEIGCKVTLR 92


>UniRef50_P38517 Cluster: 50S ribosomal protein L5; n=18; cellular
           organisms|Rep: 50S ribosomal protein L5 - Thermotoga
           maritima
          Length = 184

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 24/74 (32%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = +2

Query: 41  EDNSKNVMRNLHIRKLCLNICVGESG---DRLTRAAKVLEQLTGQQPVFSKARYTVRSFG 211
           E N KN+ +   + K+ +N+ +GE     D + R A  L ++TGQ+P+ ++AR ++ +F 
Sbjct: 23  EFNYKNIHQVPKLVKIVINMGIGEGSRNYDLIERHANELAKITGQKPIVTRARKSISNFK 82

Query: 212 IRRNEKIAVHCTVR 253
           IR+   I +  T+R
Sbjct: 83  IRKGMPIGLKVTLR 96


>UniRef50_Q9HWE7 Cluster: 50S ribosomal protein L5; n=187;
           Bacteria|Rep: 50S ribosomal protein L5 - Pseudomonas
           aeruginosa
          Length = 179

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query: 56  NVMRNLHIRKLCLNICVGES-GDR--LTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNE 226
           NVM    + K+ LN+ +GE+ GD+  +  A   LE++TGQ+PV + AR ++  F IR   
Sbjct: 24  NVMEVPRVTKITLNMGLGEAVGDKKIIENAVADLEKITGQKPVVTYARKSIAGFKIREGW 83

Query: 227 KIAVHCTVR 253
            I V  T+R
Sbjct: 84  PIGVKVTLR 92


>UniRef50_A6PPX3 Cluster: 50S ribosomal protein L5; n=1; Victivallis
           vadensis ATCC BAA-548|Rep: 50S ribosomal protein L5 -
           Victivallis vadensis ATCC BAA-548
          Length = 178

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 2/69 (2%)
 Frame = +2

Query: 53  KNVMRNLHIRKLCLNICVGESGDR--LTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNE 226
           KNVM+   + K+ ++  +G   +R   T A K +  +TGQ+PV +KAR  V +F +R   
Sbjct: 23  KNVMQIPKLEKIVISTGIGSDAERDAFTEAKKHIGAMTGQEPVITKARKNVSNFKLRVGM 82

Query: 227 KIAVHCTVR 253
            + V  T+R
Sbjct: 83  PVGVMVTLR 91


>UniRef50_Q9G893 Cluster: Ribosomal protein L5; n=1; Malawimonas
           jakobiformis|Rep: Ribosomal protein L5 - Malawimonas
           jakobiformis
          Length = 174

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 24/68 (35%), Positives = 42/68 (61%)
 Frame = +2

Query: 53  KNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKI 232
           KN+M    I+K+ +NI V +S +R+     VLE +TGQ+    KA+ ++ SF +R++  I
Sbjct: 21  KNIMEIPSIKKISVNITV-DSKNRVIEPLMVLELITGQKAKVLKAKKSISSFNLRKDMYI 79

Query: 233 AVHCTVRE 256
           A   T+++
Sbjct: 80  ACKVTLQK 87


>UniRef50_Q7R5U0 Cluster: GLP_81_173473_174138; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_81_173473_174138 - Giardia lamblia
           ATCC 50803
          Length = 221

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 22/66 (33%), Positives = 37/66 (56%)
 Frame = -3

Query: 468 LTPSVCYVETWPAKYDVKVQSINSN*GIVLDTQVNVFLNTEAKITRGGEVVTPQFIFSDF 289
           L P++   E    K  V+V +I+++  +VLD ++NVF + E +++ GGE    QF   D 
Sbjct: 63  LCPALIDAEPGARKDHVEVHTIDTHGRVVLDPEINVFRDAEPEVSSGGEARVGQFKVLDA 122

Query: 288 QTPLKD 271
           +  L D
Sbjct: 123 EAALDD 128


>UniRef50_A3GUR6 Cluster: 50S ribosomal protein L5; n=1; Vibrio
           cholerae NCTC 8457|Rep: 50S ribosomal protein L5 -
           Vibrio cholerae NCTC 8457
          Length = 112

 Score = 40.7 bits (91), Expect = 0.027
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 3/69 (4%)
 Frame = +2

Query: 56  NVMRNLHIRKLCLNICVGES-GDR--LTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNE 226
           +VM+   I K+ LN+ VGE+  D+  L  AA  +  ++GQ+P+ +KAR +V  F IR   
Sbjct: 24  SVMQVPRIEKITLNMGVGEAINDKKLLENAASDMAIISGQKPLITKARKSVAGFKIREGY 83

Query: 227 KIAVHCTVR 253
            I    T+R
Sbjct: 84  PIGCKVTLR 92


>UniRef50_A5CCK0 Cluster: 50S ribosomal protein L5; n=1; Orientia
           tsutsugamushi Boryong|Rep: 50S ribosomal protein L5 -
           Orientia tsutsugamushi (strain Boryong) (Rickettsia
           tsutsugamushi)
          Length = 189

 Score = 39.1 bits (87), Expect = 0.083
 Identities = 22/94 (23%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
 Frame = +2

Query: 8   VEER*KGEEGSEDNSKNVMRNLHIRKLCLNICVGES---GDRLTRAAKVLEQLTGQQPVF 178
           ++E+ + E   +    N  +   I+K+ + +CVG++      +    K +  +TGQ+P  
Sbjct: 13  IKEKERQELQKKFGYSNNHQTPRIKKIVVTMCVGDAVVDSKIIYYVKKCMAMITGQEPGL 72

Query: 179 SKARYTVRSFGIRRNEKIAVHCTVRELKQKKSLR 280
            KA+ ++ +F +R+   IA   T+R+ + +  +R
Sbjct: 73  IKAKKSIAAFKLRKGMPIACKVTLRKKRAEDFIR 106


>UniRef50_O04603 Cluster: 50S ribosomal protein L5, chloroplast
           precursor; n=43; cellular organisms|Rep: 50S ribosomal
           protein L5, chloroplast precursor - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 262

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 18/69 (26%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query: 56  NVMRNLHIRKLCLNICVGESGDR---LTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNE 226
           N+ +   ++K+ +N  +G++      L  A K +  +TGQ+P+ ++AR ++ +F IR ++
Sbjct: 79  NIHQVPKVQKIVVNCGIGDAAQNDKGLEAAMKDIALITGQKPIKTRARASIATFKIREDQ 138

Query: 227 KIAVHCTVR 253
            + +  T+R
Sbjct: 139 PLGIAVTLR 147


>UniRef50_Q6A6N8 Cluster: 50S ribosomal protein L5; n=125;
           Bacteria|Rep: 50S ribosomal protein L5 -
           Propionibacterium acnes
          Length = 210

 Score = 37.1 bits (82), Expect = 0.33
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = +2

Query: 53  KNVMRNLHIRKLCLNICVGESGDR---LTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 223
           +N M    + K+ +N+ VG++      +  A + +  +TGQ+P  +KAR ++  F +R  
Sbjct: 32  RNPMLIPGLEKIVVNMGVGDAAHDSKVMDGAIRDITAITGQKPQVTKARKSIAQFKLREG 91

Query: 224 EKIAVHCTVR 253
           + I  H T+R
Sbjct: 92  QPIGCHVTLR 101


>UniRef50_Q9MAT2 Cluster: F13M7.17; n=1; Arabidopsis thaliana|Rep:
           F13M7.17 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 665

 Score = 36.7 bits (81), Expect = 0.44
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 5/60 (8%)
 Frame = +1

Query: 268 EILERGLKVREYELRR--DNFSATGNFGFGIQEH---IDLGIKYDPSIGIYGLDFYVVLG 432
           E+LE+GLK  EY +       S +G  G GI+ H   +D GIK D +IG   +D Y   G
Sbjct: 283 EMLEKGLKPNEYTIAAVLSACSKSGALGSGIRIHGYILDNGIKLDRAIGTALVDMYAKCG 342


>UniRef50_P73308 Cluster: 50S ribosomal protein L5; n=227; cellular
           organisms|Rep: 50S ribosomal protein L5 - Synechocystis
           sp. (strain PCC 6803)
          Length = 180

 Score = 35.5 bits (78), Expect = 1.0
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = +2

Query: 53  KNVMRNLHIRKLCLNICVGESGDR---LTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 223
           KN+ +   + K+ +N  +GE+      L  +   L  +TGQ+PV ++AR  +  F IR  
Sbjct: 24  KNIHQVPKLTKVTVNRGLGEASQNAKALESSLTELATITGQKPVVTRARKAIAGFKIREG 83

Query: 224 EKIAVHCTVR 253
             + V  T+R
Sbjct: 84  MPVGVMVTLR 93


>UniRef50_Q6B8W5 Cluster: Chloroplast 50S ribosomal protein L5; n=4;
           Eukaryota|Rep: Chloroplast 50S ribosomal protein L5 -
           Gracilaria tenuistipitata var. liui (Red alga)
          Length = 179

 Score = 34.7 bits (76), Expect = 1.8
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +2

Query: 53  KNVMRNLHIRKLCLNICVGESGDR---LTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRN 223
           KN+ +   + K+ +N  +GE+ +    L ++   +  +TGQ+P  +K++  +  F IR N
Sbjct: 24  KNIHQIPKLVKITINRGLGEAANNKQVLEKSMNEIAAITGQKPKITKSKKAIAGFKIREN 83

Query: 224 EKIAVHCTVRELK 262
             I +  T+R  K
Sbjct: 84  IAIGLVVTLRRDK 96


>UniRef50_O21252 Cluster: Mitochondrial 60S ribosomal protein L5;
           n=3; cellular organisms|Rep: Mitochondrial 60S ribosomal
           protein L5 - Reclinomonas americana
          Length = 182

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 3/62 (4%)
 Frame = +2

Query: 77  IRKLCLNICVGESGD---RLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVHCT 247
           I K+ +N+ V E+     ++     +LE +TGQ+ + +KA+ ++ +F IR+   I V  T
Sbjct: 31  IDKIIVNMGVKEAASDKKQILAPLLILELITGQKAIVTKAKKSISNFKIRKGFPIGVSVT 90

Query: 248 VR 253
           +R
Sbjct: 91  LR 92


>UniRef50_P46749 Cluster: Mitochondrial 60S ribosomal protein L5;
           n=1; Prototheca wickerhamii|Rep: Mitochondrial 60S
           ribosomal protein L5 - Prototheca wickerhamii
          Length = 231

 Score = 33.9 bits (74), Expect = 3.1
 Identities = 19/71 (26%), Positives = 39/71 (54%), Gaps = 4/71 (5%)
 Frame = +2

Query: 53  KNVMRNLHIRKLCLNIC----VGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRR 220
           KN+M  + + K+  N       GE  + +  A   LE +TGQ+P ++ A+ ++ +F +R+
Sbjct: 60  KNIMECVSLNKIVCNTSSKHYAGEK-ESILPAFTALEMITGQKPKYTCAKKSISTFKLRQ 118

Query: 221 NEKIAVHCTVR 253
           N+ +    ++R
Sbjct: 119 NQILGCKNSLR 129


>UniRef50_Q11UJ1 Cluster: Endoglucanase, glycoside hydrolase family
           9 protein; n=1; Cytophaga hutchinsonii ATCC 33406|Rep:
           Endoglucanase, glycoside hydrolase family 9 protein -
           Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
          Length = 854

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = -2

Query: 175 YRLLSCELLQHLGGTSQPVTG-FTNTDVQAKLSDMKIPHYIFRI 47
           + + +  ++  L G   PVTG ++ TD+Q  LSD+K   Y+ R+
Sbjct: 796 FEITAKPIILDLNGREYPVTGDWSTTDIQLNLSDLKAGMYLIRL 839


>UniRef50_A6D0I6 Cluster: Putative uncharacterized protein; n=1;
           Vibrio shilonii AK1|Rep: Putative uncharacterized
           protein - Vibrio shilonii AK1
          Length = 353

 Score = 33.1 bits (72), Expect = 5.5
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
 Frame = +1

Query: 304 ELRRDNFSATGNFGFGIQEHIDLGIKYDPSIG--IYGLDFYVVLGRPGFNVAHRRRKTGK 477
           E ++D  + T  + F  +++ D+  +YD  IG  ++G+      G PG  +AH  R +  
Sbjct: 236 EFKKDFPNETLRYSFDAKDYRDIFSEYDLMIGYRVHGIGMCASQGTPGIMIAHDPRASTV 295

Query: 478 VGF 486
            GF
Sbjct: 296 KGF 298


>UniRef50_A0RPV7 Cluster: Wbgx protein; n=3; Campylobacter|Rep: Wbgx
           protein - Campylobacter fetus subsp. fetus (strain
           82-40)
          Length = 377

 Score = 32.7 bits (71), Expect = 7.2
 Identities = 13/41 (31%), Positives = 25/41 (60%)
 Frame = +1

Query: 265 EEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYD 387
           +E+ +R   +R + +  D+F   GN G+ + + +D+G KYD
Sbjct: 199 DEMAKRARLIRNHAIVNDSFDKDGNLGY-VYDVVDIGQKYD 238


>UniRef50_Q4FLN0 Cluster: 50S ribosomal protein L5; n=3;
           Bacteria|Rep: 50S ribosomal protein L5 - Pelagibacter
           ubique
          Length = 184

 Score = 32.7 bits (71), Expect = 7.2
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 2/69 (2%)
 Frame = +1

Query: 289 KVREYE-LRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVVLGRPGFNVAHRR 462
           +++++  L    F   GN+ FGI+EHI    + +D    I GLD  VV+     N  H  
Sbjct: 111 RIKDFRGLSPKGFDKFGNYTFGIKEHIIFPEVNFDRIDKIRGLDIVVVIS--ALNKDHSF 168

Query: 463 RKTGKVGFP 489
               K+ FP
Sbjct: 169 ALLEKLNFP 177


>UniRef50_A0UYZ7 Cluster: FolC bifunctional protein; n=1;
           Clostridium cellulolyticum H10|Rep: FolC bifunctional
           protein - Clostridium cellulolyticum H10
          Length = 424

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 13/99 (13%)
 Frame = +1

Query: 241 LYSPRAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHI-DLGIKYDPSIGIYG--- 408
           LY    +AEE++ER  K +  ++ + +FS   + GF + E I D     +  IG+ G   
Sbjct: 197 LYPQEQEAEEVIERVSKEKNAQIHKVDFSTIYDKGFSLSEQIFDYKDYRNIKIGLLGDHQ 256

Query: 409 -------LDFYVVLGRPGFNVAHRRRKTG--KVGFPHRL 498
                  +D   +L   GF + HR    G  K  +P RL
Sbjct: 257 MRNAAVAIDTCELLCNKGFALTHRNILDGLEKTRWPGRL 295


>UniRef50_Q61E12 Cluster: Putative uncharacterized protein CBG12266;
           n=1; Caenorhabditis briggsae|Rep: Putative
           uncharacterized protein CBG12266 - Caenorhabditis
           briggsae
          Length = 418

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 407 DWTFTSYLAGQVST*HTEGVRQEKWDFPTASQRK 508
           DWTFT++  G V+    E  ++EKWDF   S +K
Sbjct: 383 DWTFTTHYKGTVNGLKVE--KREKWDFRKNSAKK 414


>UniRef50_A4HFL7 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania braziliensis
          Length = 592

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 26/97 (26%), Positives = 41/97 (42%)
 Frame = +2

Query: 80  RKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVHCTVREL 259
           RK+      G++    T A KV E L   +P+FS     V   GIR    + +   +R  
Sbjct: 422 RKIGSVAAEGDANGETTDAGKVKEVLRSAEPIFSPLEQCVAVLGIRGRFSLELSRAIRAS 481

Query: 260 KQKKSLRGV*KSENMNCGVTTSPPRVILASVFKNTLT 370
            +    R    + + + G+ T   + I+ASV    LT
Sbjct: 482 TEDDGHR---LTTSTSIGLLTETVKNIIASVDTAQLT 515


>UniRef50_Q30TV2 Cluster: 50S ribosomal protein L5; n=2;
           Epsilonproteobacteria|Rep: 50S ribosomal protein L5 -
           Thiomicrospira denitrificans (strain ATCC 33889 / DSM
           1351)
          Length = 181

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 2/48 (4%)
 Frame = +1

Query: 289 KVREYE-LRRDNFSATGNFGFGIQEHIDL-GIKYDPSIGIYGLDFYVV 426
           +V+++  + R+ F   GN+ FG+QE +    + YD  + I+G++  VV
Sbjct: 109 RVKDFRGVPRNGFDGRGNYNFGLQEQLIFPEVSYDSVMQIHGMNITVV 156


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 576,407,203
Number of Sequences: 1657284
Number of extensions: 12198545
Number of successful extensions: 32432
Number of sequences better than 10.0: 45
Number of HSP's better than 10.0 without gapping: 31457
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32414
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 44807090004
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -