SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20025
         (696 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    25   0.45 
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    24   1.0  
EF592537-1|ABQ95983.1|  593|Tribolium castaneum beta-N-acetylglu...    23   2.4  
AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      22   4.2  
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      22   4.2  
AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine recombi...    22   5.5  
AM292371-1|CAL23183.2|  350|Tribolium castaneum gustatory recept...    22   5.5  
X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.       21   7.3  

>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 25.4 bits (53), Expect = 0.45
 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 3/41 (7%)
 Frame = -1

Query: 519 GGVCTTRINMHYINDVPHITASGC---LGLALIGSCLNSST 406
           GG C   IN +     P  T S C   + L     CLN +T
Sbjct: 35  GGTCIDGINSYICTCKPGFTGSNCQNRINLCDSSPCLNGAT 75


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 24.2 bits (50), Expect = 1.0
 Identities = 11/39 (28%), Positives = 19/39 (48%)
 Frame = -3

Query: 655 PMIPMQFQIRDPAPYVPIQIKNSQRSQCDTTSKTNTHQL 539
           P+ PMQ QI +P P +      +  +    ++K N+  L
Sbjct: 408 PVPPMQSQIINPQPQITSPSNTNTSTSSTNSNKPNSSDL 446


>EF592537-1|ABQ95983.1|  593|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG2 protein.
          Length = 593

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 12/35 (34%), Positives = 17/35 (48%)
 Frame = -2

Query: 428 VVVSIVVPTGLLLLGLAPCCWFDVVAEASPSWPFW 324
           VV +  +PTG   LG   C W + V ++S     W
Sbjct: 504 VVYNNKIPTGDGALGGEVCMWGEYVDDSSVESRVW 538


>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 22.2 bits (45), Expect = 4.2
 Identities = 8/22 (36%), Positives = 9/22 (40%)
 Frame = -3

Query: 340 HPGHFGAEPDFVLPAPPGNCAD 275
           HP H  + P  V P P     D
Sbjct: 239 HPPHLSSHPAIVTPGPKQELPD 260


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 22.2 bits (45), Expect = 4.2
 Identities = 8/22 (36%), Positives = 9/22 (40%)
 Frame = -3

Query: 340 HPGHFGAEPDFVLPAPPGNCAD 275
           HP H  + P  V P P     D
Sbjct: 131 HPPHLSSHPAIVTPGPKQELPD 152


>AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine
           recombinase protein.
          Length = 340

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 9/17 (52%), Positives = 10/17 (58%)
 Frame = +3

Query: 267 PSASAQFPGGAGRTKSG 317
           PSAS  FPGG    + G
Sbjct: 11  PSASEAFPGGRTLVEKG 27


>AM292371-1|CAL23183.2|  350|Tribolium castaneum gustatory receptor
           candidate 50 protein.
          Length = 350

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = -2

Query: 239 DLPHGVHRENCD 204
           D+ HGVH E C+
Sbjct: 212 DIVHGVHNELCN 223


>X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.
          Length = 524

 Score = 21.4 bits (43), Expect = 7.3
 Identities = 8/26 (30%), Positives = 14/26 (53%)
 Frame = +1

Query: 475 IIYVVHVDSSCAHSTSTCLVCTTDEC 552
           ++Y +H+     H+  TC +C   EC
Sbjct: 484 VLYTIHMGYHGFHNPFTCNMCGV-EC 508


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 151,047
Number of Sequences: 336
Number of extensions: 3339
Number of successful extensions: 9
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18322480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -