SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30133.Seq
         (693 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory recept...    25   0.78 
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    25   0.78 
AM712901-1|CAN84640.1|  205|Tribolium castaneum hypothetical pro...    24   1.4  
AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory recept...    23   2.4  
AM292332-1|CAL23144.2|  344|Tribolium castaneum gustatory recept...    23   2.4  
AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    23   3.1  
AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory recept...    22   4.1  
AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory recept...    22   5.5  
AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory recept...    21   7.2  
DQ659248-1|ABG47446.1|  496|Tribolium castaneum chitinase 8 prot...    21   9.6  
AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase prot...    21   9.6  

>AM292352-1|CAL23164.1|  250|Tribolium castaneum gustatory receptor
           candidate 31 protein.
          Length = 250

 Score = 24.6 bits (51), Expect = 0.78
 Identities = 10/37 (27%), Positives = 21/37 (56%)
 Frame = -2

Query: 626 NFDAQ*PRYFELLYSAVLTFIIFTLLEVVFFXFYILR 516
           +F+A   ++++  YSA+ T I F+L + +      +R
Sbjct: 61  SFEADLRQFYKTAYSAIFTVIDFSLCKAILVHAITIR 97


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 24.6 bits (51), Expect = 0.78
 Identities = 10/31 (32%), Positives = 16/31 (51%)
 Frame = -1

Query: 603 IFRITLFRCTYVYYFYTIRSGVFFXLYFTYY 511
           IF +    CTY +Y+  I   +   +Y+ YY
Sbjct: 91  IFTVHFLLCTYYFYYAFI---ILLCVYYFYY 118



 Score = 21.8 bits (44), Expect = 5.5
 Identities = 8/33 (24%), Positives = 17/33 (51%), Gaps = 4/33 (12%)
 Frame = -1

Query: 594 ITLFRCTYVYYF----YTIRSGVFFXLYFTYYM 508
           + +  C Y +Y+    +T+   +   +Y+ YYM
Sbjct: 232 LIILLCIYYFYYAFILFTVHLLLLVCIYYFYYM 264


>AM712901-1|CAN84640.1|  205|Tribolium castaneum hypothetical
           protein protein.
          Length = 205

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 13/50 (26%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = -2

Query: 599 FELLYSAVLTFIIFTLLEVVFFXFYILRIICAKNLTRNI--IVHRMTCDS 456
           F LL++  + F++ +   +VF    +  +  A+ LT  I  +V+   CD+
Sbjct: 116 FFLLWTPAVIFVVLSKNGIVFAGLIVFILFFAQGLTSPIFNLVYVYCCDN 165


>AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory receptor
           candidate 55 protein.
          Length = 402

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 12/46 (26%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = +2

Query: 35  YYS-KVTSYNIMSIXXXXXXXXXXXXYIVNNSNLVFKSLFNVLLIT 169
           Y+S  +TSY ++S+             +V N  L+F   F ++ +T
Sbjct: 57  YFSFYITSYTLLSVYSLFRIATNENNSLVINKRLIFIECFVMMALT 102


>AM292332-1|CAL23144.2|  344|Tribolium castaneum gustatory receptor
           candidate 11 protein.
          Length = 344

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 12/46 (26%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = +2

Query: 35  YYS-KVTSYNIMSIXXXXXXXXXXXXYIVNNSNLVFKSLFNVLLIT 169
           Y+S  +TSY ++S+             +V N  L+F   F ++ +T
Sbjct: 57  YFSFYITSYTLLSVYSLFRIATNENNSLVINKRLIFIECFVMMALT 102


>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 22.6 bits (46), Expect = 3.1
 Identities = 11/40 (27%), Positives = 19/40 (47%)
 Frame = -2

Query: 413 VALLSIVFSYSYFCFNSILFRLNLLRRPHKYINYVYPCTK 294
           V+LL +VF + YF +   ++ +         IN+ Y   K
Sbjct: 138 VSLLQLVFVFCYFIYLFTVYYIYYSVHEASIINFGYTLAK 177



 Score = 22.2 bits (45), Expect = 4.1
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = -3

Query: 577 YLRLLFLHY*KWCFFXFIFYVLYVPRI*HE 488
           Y+ LL L +  +C+F ++F V Y+    HE
Sbjct: 137 YVSLLQLVF-VFCYFIYLFTVYYIYYSVHE 165


>AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory receptor
           candidate 42 protein.
          Length = 347

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 5/12 (41%), Positives = 10/12 (83%)
 Frame = -1

Query: 540 VFFXLYFTYYMC 505
           ++F  Y+TY++C
Sbjct: 152 LYFQFYYTYFLC 163


>AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory receptor
           candidate 16 protein.
          Length = 452

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = -2

Query: 590 LYSAVLTFIIFTLLEVVFF 534
           +   V  F+IF +L +VFF
Sbjct: 39  IVQTVAYFVIFIILTIVFF 57


>AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory receptor
           candidate 60 protein.
          Length = 364

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 7/18 (38%), Positives = 12/18 (66%)
 Frame = -1

Query: 540 VFFXLYFTYYMCQEFNTK 487
           V F LY+  ++CQ  +T+
Sbjct: 261 VIFELYYLSHVCQNVSTE 278


>DQ659248-1|ABG47446.1|  496|Tribolium castaneum chitinase 8
           protein.
          Length = 496

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = -1

Query: 186 QYQFVEVINKTLKSD 142
           +YQ +  IN  LKSD
Sbjct: 375 KYQILNAINAALKSD 389


>AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase
           protein.
          Length = 590

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 604 DISNYFIPLYLRL 566
           D+ N+F+PL  RL
Sbjct: 125 DLENHFVPLVQRL 137


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 133,651
Number of Sequences: 336
Number of extensions: 2617
Number of successful extensions: 15
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18218375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -