SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov2p23
         (399 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF222295-1|ABN79655.1|  146|Tribolium castaneum arginine vasopre...    22   1.9  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    22   1.9  
L01616-1|AAA30096.1|   74|Tribolium castaneum zinc finger protei...    21   3.4  
EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    21   3.4  
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    21   3.4  
U77974-1|AAB36556.1|  276|Tribolium castaneum transcription fact...    21   4.5  
AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    21   5.9  
EU019713-1|ABU25225.1|  528|Tribolium castaneum chitin deacetyla...    20   7.8  
EU019712-1|ABU25224.1|  535|Tribolium castaneum chitin deacetyla...    20   7.8  

>EF222295-1|ABN79655.1|  146|Tribolium castaneum arginine
           vasopressin-like peptide protein.
          Length = 146

 Score = 22.2 bits (45), Expect = 1.9
 Identities = 10/27 (37%), Positives = 12/27 (44%), Gaps = 1/27 (3%)
 Frame = +1

Query: 253 CDASTA-CRRKACPCPVAARCCQWKSC 330
           C A +A CR+    C     CC   SC
Sbjct: 90  CIAGSAPCRKNTGRCAFDGICCSQDSC 116


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 22.2 bits (45), Expect = 1.9
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = -2

Query: 293 QGHAFRRHAVLASQVASLSERYSQVVVSTT 204
           Q H + R     S+ +S+SER S  V S T
Sbjct: 796 QSHHYGRRERSGSESSSISERCSSRVESLT 825


>L01616-1|AAA30096.1|   74|Tribolium castaneum zinc finger protein
           protein.
          Length = 74

 Score = 21.4 bits (43), Expect = 3.4
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -1

Query: 174 PHGCHHCTI 148
           P+GC HC++
Sbjct: 65  PYGCEHCSM 73


>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 21.4 bits (43), Expect = 3.4
 Identities = 10/35 (28%), Positives = 14/35 (40%)
 Frame = +3

Query: 12  LFTYVQ*ADRNKMKIRTNNFSSLYRIFECDLXTIK 116
           +F+Y       + K    NF + Y  FE    T K
Sbjct: 13  MFSYTDNVSSTRTKYLRTNFPNFYNDFEVQRYTWK 47


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 21.4 bits (43), Expect = 3.4
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -1

Query: 174 PHGCHHCTI 148
           P+GC HC++
Sbjct: 218 PYGCEHCSM 226


>U77974-1|AAB36556.1|  276|Tribolium castaneum transcription factor
           homolog protein.
          Length = 276

 Score = 21.0 bits (42), Expect = 4.5
 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 2/50 (4%)
 Frame = +2

Query: 167 PCGGGGLIKRPTWSSTQLPANIS-H*AMQPAMQV-LHAGGRRAPVQSQLA 310
           P    GL   P  + TQLP N+      Q   +V   +  R +PVQS ++
Sbjct: 190 PLQNPGLNLNPPVTQTQLPLNLGLDFPYQGKFEVPTKSSPRSSPVQSDVS 239


>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 20.6 bits (41), Expect = 5.9
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 355 PPAWTSCGSP 384
           PPA TS GSP
Sbjct: 35  PPATTSSGSP 44


>EU019713-1|ABU25225.1|  528|Tribolium castaneum chitin deacetylase
           2B protein.
          Length = 528

 Score = 20.2 bits (40), Expect = 7.8
 Identities = 8/21 (38%), Positives = 12/21 (57%)
 Frame = +3

Query: 183 ASLSDLHGRRHNYLRISLTER 245
           +++ DLH R H     SLT +
Sbjct: 233 SAVQDLHRRGHEIAVFSLTHK 253


>EU019712-1|ABU25224.1|  535|Tribolium castaneum chitin deacetylase
           2A protein.
          Length = 535

 Score = 20.2 bits (40), Expect = 7.8
 Identities = 8/21 (38%), Positives = 12/21 (57%)
 Frame = +3

Query: 183 ASLSDLHGRRHNYLRISLTER 245
           +++ DLH R H     SLT +
Sbjct: 240 SAVQDLHRRGHEIAVFSLTHK 260


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 90,745
Number of Sequences: 336
Number of extensions: 2012
Number of successful extensions: 14
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 122,585
effective HSP length: 51
effective length of database: 105,449
effective search space used:  8541369
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2022 -