SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120038.Seq
         (762 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      24   1.5  
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      24   1.5  
AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    23   2.0  
DQ855491-1|ABH88178.1|  144|Tribolium castaneum chemosensory pro...    22   6.1  
DQ855506-1|ABH88193.1|  124|Tribolium castaneum chemosensory pro...    21   8.1  
AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    21   8.1  
AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembran...    21   8.1  
AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembran...    21   8.1  

>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -1

Query: 609 DRQHHLDAFGRWSRRKNAIR 550
           +RQ H+  +  WS R NA R
Sbjct: 535 ERQLHMQLYPDWSSRANATR 554


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -1

Query: 609 DRQHHLDAFGRWSRRKNAIR 550
           +RQ H+  +  WS R NA R
Sbjct: 427 ERQLHMQLYPDWSSRANATR 446


>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = +2

Query: 551 RIAFFRRDQRPNASRWCWRSI 613
           R+A+FR D   N   W W  +
Sbjct: 193 RLAYFREDLGINLHHWHWHLV 213


>DQ855491-1|ABH88178.1|  144|Tribolium castaneum chemosensory
           protein 5 protein.
          Length = 144

 Score = 21.8 bits (44), Expect = 6.1
 Identities = 6/17 (35%), Positives = 12/17 (70%)
 Frame = +3

Query: 96  IVSFDACITYKSPCSPD 146
           ++++  C+  K PCSP+
Sbjct: 53  LLNYINCLLEKGPCSPE 69


>DQ855506-1|ABH88193.1|  124|Tribolium castaneum chemosensory
           protein 20 protein.
          Length = 124

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +3

Query: 114 CITYKSPCSPD 146
           C+  K PC+PD
Sbjct: 48  CLLEKKPCTPD 58


>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 7/21 (33%), Positives = 11/21 (52%)
 Frame = +2

Query: 551 RIAFFRRDQRPNASRWCWRSI 613
           R+A++R D   N   W W  +
Sbjct: 193 RVAYWREDIGLNLHHWHWHLV 213


>AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembrane
           transporter protein.
          Length = 669

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 11/37 (29%), Positives = 21/37 (56%)
 Frame = +2

Query: 395 NNEEAVNVICDNLKYTEVSQAARNALYTAFTQLQEAF 505
           ++ +AVN+ICD  K+   +   + AL  A T+ +  +
Sbjct: 341 SSRQAVNLICD--KFERSNIGVKIALEAATTEREGGY 375


>AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembrane
           transporter white protein.
          Length = 669

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 11/37 (29%), Positives = 21/37 (56%)
 Frame = +2

Query: 395 NNEEAVNVICDNLKYTEVSQAARNALYTAFTQLQEAF 505
           ++ +AVN+ICD  K+   +   + AL  A T+ +  +
Sbjct: 341 SSRQAVNLICD--KFERSNIGVKIALEAATTEREGGY 375


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 183,458
Number of Sequences: 336
Number of extensions: 3860
Number of successful extensions: 10
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20442493
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -