SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120036.Seq
         (735 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    23   2.6  
AJ969955-1|CAI94742.1|  160|Tribolium castaneum torso-like prote...    22   4.5  
AM292357-1|CAL23169.2|  355|Tribolium castaneum gustatory recept...    21   7.8  

>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 10/38 (26%), Positives = 18/38 (47%)
 Frame = +1

Query: 595 LICKSYRQNYVNFNGCHKAFSFSLLFVRLRIRFYCQLL 708
           L+C  Y   ++ F  C   F  + +   + + FYC L+
Sbjct: 196 LLCLDYFTLHLLFLPCIYYFYSAFIIFTIHLLFYCVLI 233


>AJ969955-1|CAI94742.1|  160|Tribolium castaneum torso-like protein
           protein.
          Length = 160

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = -3

Query: 529 VHKEHSRVEVDLNRYTD 479
           VHKEH  V V L R+ D
Sbjct: 35  VHKEHCYVLVRLARFRD 51


>AM292357-1|CAL23169.2|  355|Tribolium castaneum gustatory receptor
           candidate 36 protein.
          Length = 355

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = -2

Query: 365 TIEITLRAV*NTFGTVFVL 309
           TI   L A+ NTFGT+ ++
Sbjct: 257 TISYILFALFNTFGTILLI 275


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,603
Number of Sequences: 336
Number of extensions: 3526
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19675845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -