SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120006.Seq
         (617 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    22   3.6  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    22   3.6  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   4.7  
U81040-1|AAB39356.1|  283|Tribolium castaneum TC Deformed protein.     21   8.3  
U81038-1|AAB39355.1|  412|Tribolium castaneum transcription fact...    21   8.3  
AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.           21   8.3  

>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 22.2 bits (45), Expect = 3.6
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 468 LTPSVCYVETWPAKYDVKVQSINSN*GIVLD 376
           LT +VC+V    A +  K  SIN N  + LD
Sbjct: 190 LTNAVCFVPGVVAMFSRKPCSINENLKMGLD 220


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 22.2 bits (45), Expect = 3.6
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 468 LTPSVCYVETWPAKYDVKVQSINSN*GIVLD 376
           LT +VC+V    A +  K  SIN N  + LD
Sbjct: 190 LTNAVCFVPGVVAMFSRKPCSINENLKMGLD 220


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.8 bits (44), Expect = 4.7
 Identities = 9/25 (36%), Positives = 12/25 (48%)
 Frame = -3

Query: 180  ENTGCCPVSCSNTLAARVSLSPDSP 106
            ENT C P + S    +   + PD P
Sbjct: 2280 ENTECHPDASSTMAPSTTPMVPDKP 2304


>U81040-1|AAB39356.1|  283|Tribolium castaneum TC Deformed protein.
          Length = 283

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -2

Query: 343 QNYPWRRSCHAA 308
           Q YPW R  H A
Sbjct: 209 QIYPWMRKVHVA 220


>U81038-1|AAB39355.1|  412|Tribolium castaneum transcription factor
           Deformed protein.
          Length = 412

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -2

Query: 343 QNYPWRRSCHAA 308
           Q YPW R  H A
Sbjct: 209 QIYPWMRKVHVA 220


>AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.
          Length = 412

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -2

Query: 343 QNYPWRRSCHAA 308
           Q YPW R  H A
Sbjct: 209 QIYPWMRKVHVA 220


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 136,505
Number of Sequences: 336
Number of extensions: 3087
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15770591
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -