SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120005.Seq
         (647 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    26   0.23 
DQ855491-1|ABH88178.1|  144|Tribolium castaneum chemosensory pro...    22   5.0  
DQ855506-1|ABH88193.1|  124|Tribolium castaneum chemosensory pro...    21   6.6  
AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembran...    21   6.6  
AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembran...    21   6.6  
EF125544-1|ABL73928.1|  279|Tribolium castaneum obstractor B pro...    21   8.7  
AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain tran...    21   8.7  
AF228509-1|AAF69136.1|  325|Tribolium castaneum prothoraxless pr...    21   8.7  

>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 26.2 bits (55), Expect = 0.23
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = +2

Query: 500 SFHSGTQRVIHSVYATTRSILDTTNPNTFCSRV 598
           +FH G+Q V+H+V    ++ + T +  TF   V
Sbjct: 379 TFHIGSQLVLHTVKTVLKTTMSTFSDITFMRTV 411


>DQ855491-1|ABH88178.1|  144|Tribolium castaneum chemosensory
           protein 5 protein.
          Length = 144

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 6/17 (35%), Positives = 12/17 (70%)
 Frame = +1

Query: 151 IVSFDACITYKSPCSPD 201
           ++++  C+  K PCSP+
Sbjct: 53  LLNYINCLLEKGPCSPE 69


>DQ855506-1|ABH88193.1|  124|Tribolium castaneum chemosensory
           protein 20 protein.
          Length = 124

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +1

Query: 169 CITYKSPCSPD 201
           C+  K PC+PD
Sbjct: 48  CLLEKKPCTPD 58


>AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembrane
           transporter protein.
          Length = 669

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 10/37 (27%), Positives = 21/37 (56%)
 Frame = +3

Query: 450 NNEEAVNVICDNLKYTEVFTAARNALYTAFTQLQEAF 560
           ++ +AVN+ICD  + + +    + AL  A T+ +  +
Sbjct: 341 SSRQAVNLICDKFERSNI--GVKIALEAATTEREGGY 375


>AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembrane
           transporter white protein.
          Length = 669

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 10/37 (27%), Positives = 21/37 (56%)
 Frame = +3

Query: 450 NNEEAVNVICDNLKYTEVFTAARNALYTAFTQLQEAF 560
           ++ +AVN+ICD  + + +    + AL  A T+ +  +
Sbjct: 341 SSRQAVNLICDKFERSNI--GVKIALEAATTEREGGY 375


>EF125544-1|ABL73928.1|  279|Tribolium castaneum obstractor B
           protein.
          Length = 279

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -2

Query: 118 VAAPYPRALAPYCCRYKY 65
           VAA +PR   P  C+Y Y
Sbjct: 179 VAATHPRYADPDDCQYFY 196


>AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain
           transcription factor Prothoraxlessprotein.
          Length = 323

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = +1

Query: 550 KKHSRHHKPEH 582
           ++H +HH+P H
Sbjct: 173 EQHPQHHQPHH 183


>AF228509-1|AAF69136.1|  325|Tribolium castaneum prothoraxless
           protein.
          Length = 325

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = +1

Query: 550 KKHSRHHKPEH 582
           ++H +HH+P H
Sbjct: 175 EQHPQHHQPHH 185


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 149,817
Number of Sequences: 336
Number of extensions: 3087
Number of successful extensions: 9
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16656800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -