Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP01_F_A05
         (1023 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      22   6.6  
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      22   6.6  
AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     22   8.7  

>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 22.2 bits (45), Expect = 6.6
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +2

Query: 863 PPPPKPXXXPP 895
           PPPP P   PP
Sbjct: 736 PPPPHPHHQPP 746


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 22.2 bits (45), Expect = 6.6
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +2

Query: 863 PPPPKPXXXPP 895
           PPPP P   PP
Sbjct: 628 PPPPHPHHQPP 638


>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 2/31 (6%)
 Frame = +3

Query: 174 SGNGYEPIDNR--PYIVNPPKDYNPNGNGYE 260
           S +G++  D    P+IV  P++ NP+   Y+
Sbjct: 179 SHSGFQRSDGTFGPFIVRVPEEDNPHAKLYD 209


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 160,712
Number of Sequences: 336
Number of extensions: 2979
Number of successful extensions: 8
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 58
effective length of database: 103,097
effective search space used: 29073354
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)