BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV40036 (890 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pomb... 32 0.13 SPBC30B4.05 |kap109||karyopherin Kap109|Schizosaccharomyces pomb... 28 1.6 SPAC27D7.13c |ssm4|SPAC637.01c|p150-Glued|Schizosaccharomyces po... 27 2.7 SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pom... 27 2.7 SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|... 26 6.3 SPAC13F5.07c |||previusly annotated as dubious, may not be prote... 26 6.3 SPAC4G8.05 |ppk14||serine/threonine protein kinase Ppk14 |Schizo... 26 8.3 >SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pombe|chr 2|||Manual Length = 1018 Score = 31.9 bits (69), Expect = 0.13 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 293 KKVNLEAWQDSVEGPDILARTNKWIKDKV 379 KKVNL +W +S E + L R KW DK+ Sbjct: 937 KKVNLPSWAESPELREQLKRQQKWDPDKI 965 >SPBC30B4.05 |kap109||karyopherin Kap109|Schizosaccharomyces pombe|chr 2|||Manual Length = 967 Score = 28.3 bits (60), Expect = 1.6 Identities = 16/55 (29%), Positives = 31/55 (56%) Frame = -3 Query: 660 VSGHHIHLDITATLQHGIVNTTRSAAFVVKPILMVIEDKMIKYIMSFLKTINSQE 496 V+ ++ +D+ A ++ I A V+ P+++ ED IKY+ +F +NSQ+ Sbjct: 439 VTSINLMVDVVAFFENNIKPDLLQPAGVIHPMVLA-ED--IKYVFTFRNQLNSQQ 490 >SPAC27D7.13c |ssm4|SPAC637.01c|p150-Glued|Schizosaccharomyces pombe|chr 1|||Manual Length = 670 Score = 27.5 bits (58), Expect = 2.7 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +3 Query: 147 GSFSKRQL-AELRRVSLARLICDNTDMKQ 230 GS+ K L +ELR+ L L+C+NT +K+ Sbjct: 201 GSYLKENLKSELRKGRLDELMCENTALKE 229 >SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1158 Score = 27.5 bits (58), Expect = 2.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 207 CDNTDMKQLQRDVFETLLIATLSC 278 C+N + + DV +TLL+ T SC Sbjct: 28 CENAGLTAVVNDVIDTLLLGTSSC 51 >SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1469 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 41 SSWFSSRTNCY*SI*GTIVAYSHRGPLFLQP 133 S W NC+ S+ G I++ S P+F+ P Sbjct: 1009 SGWLFFSINCFLSVAGGILSVSSAMPIFMIP 1039 >SPAC13F5.07c |||previusly annotated as dubious, may not be protein coding|Schizosaccharomyces pombe|chr 1|||Manual Length = 105 Score = 26.2 bits (55), Expect = 6.3 Identities = 18/59 (30%), Positives = 27/59 (45%) Frame = +3 Query: 27 MAEKHLPGSLLGPTATSLFKEQLWRTRIADRYFYSHVNEAGSFSKRQLAELRRVSLARL 203 + E + SL G TA S Q W ++ D HV+E+ R+L E V+ +L Sbjct: 9 LGEDDIVNSLDGITALS----QEWIDKVVDAINEGHVSESDERESRKLGEKMNVNSQKL 63 >SPAC4G8.05 |ppk14||serine/threonine protein kinase Ppk14 |Schizosaccharomyces pombe|chr 1|||Manual Length = 566 Score = 25.8 bits (54), Expect = 8.3 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = -2 Query: 763 LVP*LVTFSLEGSPNIEHIDIETRKRPVFRGPKSRKWTSYPL 638 ++P L +G+PNI H+ E++ + P++ + PL Sbjct: 500 IIPKLAPIDEKGNPNISHLK-ESKSLDITHSPQNTQTVEVPL 540 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,761,884 Number of Sequences: 5004 Number of extensions: 79128 Number of successful extensions: 190 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 181 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 190 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 448490560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -